Active Recombinant human CA5A Full Length protein, His-tagged
Cat.No. : | CA5A-719H |
Product Overview : | Recombinant Human CA5A protein(Ala40-Ser305), fused with C-terminal His tag, was expressed in E. coli. |
Availability | July 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Ala40-Ser305 |
Tag : | C-His |
Form : | Liquid in sterile PBS, pH7.4, 10% Glycerol, 8% Trehalose. |
Bio-activity : | Measured by its esterase activity. The specific activity is >500 pmoles/min/μg. |
Molecular Mass : | The protein has a calculated MW of 31 kDa. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 90 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.9 mg/ml. |
Reconstitution : | Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MAWQTSNNTLHPLWTVPVSVPGGTRQSPINIQWRDSVYDPQLKPLRVSYEAASCLYIWNTGYLFQVEFDDATEASGISGGPLENHYRLKQFHFHWGAVNEGGSEHTVDGHAYPAELHLVHWNSVKYQNYKEAVVGENGLAVIGVFLKLGAHHQTLQRLVDILPEIKHKDARAAMRPFDPSTLLPTCWDYWTYAGSLTTPPLTESVTWIIQKEPVEVAPSQLSAFRTLLFSALGEEEKMMVNNYRPLQPLMNRKVWASFQATNEGTRSAHHHHHHHHHH |
Gene Name | CA5A carbonic anhydrase VA, mitochondrial [ Homo sapiens ] |
Official Symbol | CA5A |
Synonyms | CA5A; carbonic anhydrase VA, mitochondrial; CA5; carbonic anhydrase 5A, mitochondrial; CAV; CAVA; CA-VA; carbonic dehydratase; carbonate dehydratase VA; carbonic anhydrase V, mitochondrial; |
Gene ID | 763 |
mRNA Refseq | NM_001739 |
Protein Refseq | NP_001730 |
MIM | 114761 |
UniProt ID | P35218 |
◆ Recombinant Proteins | ||
CA5A-8564H | Recombinant Human CA5A protein | +Inquiry |
CA5a-719R | Recombinant Rat CA5a Protein, His (Fc)-Avi-tagged | +Inquiry |
CAR5A-1134R | Recombinant Rat CAR5A Protein | +Inquiry |
CA5A-2269H | Recombinant Human CA5A Protein, MYC/DDK-tagged | +Inquiry |
CA5A-0242H | Recombinant Human CA5A Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CA5A Products
Required fields are marked with *
My Review for All CA5A Products
Required fields are marked with *