Active Recombinant Human CCL15 Protein (92 aa)
| Cat.No. : | CCL15-326C |
| Product Overview : | Recombinant human MIP-5/CCL15 (rhMIP-5/CCL15) produced in E. coli is a single non-glycosylated polypeptide chain containing 92 amino acids. A fully biologically active molecule, rhMIP-5/CCL15 has a molecular mass of 10.2 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Protein Length : | 92 |
| Description : | Macrophage Inflammatory Protein-5 (MIP-5/CCL15) is a chemokine originally identified in the human hemofiltrate, thus it is also named Hemofiltrate CC Chemokine-2 (HCC-2). MIP-5 belongs to the CCL chemokine family, and its receptors are G-protein coupled receptors CCR1 and CCR3, with CCR1 being the major one. MIP-5 is mainly expressed in heart and skeletal muscle, and CCR1 is expressed on Th1 and Th2 cells in human cord blood lymphocytes. In vivo, MIP-5 promotes the accumulation of immature myeloid cells and the expansion of metastatic foci in the lever. MIP-5 contributes to severe asthma, sarcoidosis, and atherosclerosis;however, MIP-5 can also inhibit stem cell proliferation, implicating its therapeutic potential as an alternative to high dose chemotherapy. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | ED50 < 2 μg/mL, measured by the FLIPR assay using CHO cells transfected with human CCR1, the receptor of human CCL15, corresponding to a specific activity of > 500 units/mg. |
| Molecular Mass : | 10.2 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : | QFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI |
| Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
| Purity : | > 95% by SDS-PAGE analysis. |
| Storage : | Lyophilized recombinant human MIP-5/CCL15 (rhMIP-5/CCL15) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhMIP-5/CCL15 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
| Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
| Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
| Gene Name | CCL15 chemokine (C-C motif) ligand 15 [ Homo sapiens ] |
| Official Symbol | CCL15 |
| Synonyms | CCL15; chemokine (C-C motif) ligand 15; SCYA15, small inducible cytokine subfamily A (Cys Cys), member 15; C-C motif chemokine 15; CC chemokine 3; chemokine CC 2; HCC 2; HMRP 2B; leukotactin 1; Lkn 1; macrophage inflammatory protein 5; MIP 1 delta; MIP 1d; MIP 5; NCC 3; SCYL3; MIP-1 delta; chemokine CC-2; new CC chemokine 3; small-inducible cytokine A15; small inducible cytokine subfamily A (Cys-Cys), member 15; LKN1; NCC3; SY15; HCC-2; LKN-1; MIP-5; NCC-3; MIP-1D; MRP-2B; SCYA15; HMRP-2B; |
| Gene ID | 6359 |
| mRNA Refseq | NM_032965 |
| Protein Refseq | NP_116741 |
| MIM | 601393 |
| UniProt ID | Q16663 |
| ◆ Recombinant Proteins | ||
| CCL15-198H | Recombinant Human CCL15 protein, His-tagged | +Inquiry |
| CCL15-256H | Recombinant Human CCL15 protein(Ser46-Ile113), His-tagged | +Inquiry |
| CCL15-326C | Active Recombinant Human CCL15 Protein (92 aa) | +Inquiry |
| CCL15-0611H | Recombinant Human CCL15 Protein, GST-Tagged | +Inquiry |
| CCL15-151H | Recombinant Human CCL15 Protein, DYKDDDDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CCL15-7731HCL | Recombinant Human CCL15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCL15 Products
Required fields are marked with *
My Review for All CCL15 Products
Required fields are marked with *



