Active Recombinant Human CCL15 Protein (92 aa)

Cat.No. : CCL15-326C
Product Overview : Recombinant human MIP-5/CCL15 (rhMIP-5/CCL15) produced in E. coli is a single non-glycosylated polypeptide chain containing 92 amino acids. A fully biologically active molecule, rhMIP-5/CCL15 has a molecular mass of 10.2 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 92
Description : Macrophage Inflammatory Protein-5 (MIP-5/CCL15) is a chemokine originally identified in the human hemofiltrate, thus it is also named Hemofiltrate CC Chemokine-2 (HCC-2). MIP-5 belongs to the CCL chemokine family, and its receptors are G-protein coupled receptors CCR1 and CCR3, with CCR1 being the major one. MIP-5 is mainly expressed in heart and skeletal muscle, and CCR1 is expressed on Th1 and Th2 cells in human cord blood lymphocytes. In vivo, MIP-5 promotes the accumulation of immature myeloid cells and the expansion of metastatic foci in the lever. MIP-5 contributes to severe asthma, sarcoidosis, and atherosclerosis;however, MIP-5 can also inhibit stem cell proliferation, implicating its therapeutic potential as an alternative to high dose chemotherapy.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 2 μg/mL, measured by the FLIPR assay using CHO cells transfected with human CCR1, the receptor of human CCL15, corresponding to a specific activity of > 500 units/mg.
Molecular Mass : 10.2 kDa, observed by reducing SDS-PAGE.
AA Sequence : QFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE analysis.
Storage : Lyophilized recombinant human MIP-5/CCL15 (rhMIP-5/CCL15) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhMIP-5/CCL15 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name CCL15 chemokine (C-C motif) ligand 15 [ Homo sapiens ]
Official Symbol CCL15
Synonyms CCL15; chemokine (C-C motif) ligand 15; SCYA15, small inducible cytokine subfamily A (Cys Cys), member 15; C-C motif chemokine 15; CC chemokine 3; chemokine CC 2; HCC 2; HMRP 2B; leukotactin 1; Lkn 1; macrophage inflammatory protein 5; MIP 1 delta; MIP 1d; MIP 5; NCC 3; SCYL3; MIP-1 delta; chemokine CC-2; new CC chemokine 3; small-inducible cytokine A15; small inducible cytokine subfamily A (Cys-Cys), member 15; LKN1; NCC3; SY15; HCC-2; LKN-1; MIP-5; NCC-3; MIP-1D; MRP-2B; SCYA15; HMRP-2B;
Gene ID 6359
mRNA Refseq NM_032965
Protein Refseq NP_116741
MIM 601393
UniProt ID Q16663

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CCL15 Products

Required fields are marked with *

My Review for All CCL15 Products

Required fields are marked with *

0
cart-icon