Active Recombinant Human CCL15 Protein (92 aa)
Cat.No. : | CCL15-326C |
Product Overview : | Recombinant human MIP-5/CCL15 (rhMIP-5/CCL15) produced in E. coli is a single non-glycosylated polypeptide chain containing 92 amino acids. A fully biologically active molecule, rhMIP-5/CCL15 has a molecular mass of 10.2 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 92 |
Description : | Macrophage Inflammatory Protein-5 (MIP-5/CCL15) is a chemokine originally identified in the human hemofiltrate, thus it is also named Hemofiltrate CC Chemokine-2 (HCC-2). MIP-5 belongs to the CCL chemokine family, and its receptors are G-protein coupled receptors CCR1 and CCR3, with CCR1 being the major one. MIP-5 is mainly expressed in heart and skeletal muscle, and CCR1 is expressed on Th1 and Th2 cells in human cord blood lymphocytes. In vivo, MIP-5 promotes the accumulation of immature myeloid cells and the expansion of metastatic foci in the lever. MIP-5 contributes to severe asthma, sarcoidosis, and atherosclerosis;however, MIP-5 can also inhibit stem cell proliferation, implicating its therapeutic potential as an alternative to high dose chemotherapy. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 2 μg/mL, measured by the FLIPR assay using CHO cells transfected with human CCR1, the receptor of human CCL15, corresponding to a specific activity of > 500 units/mg. |
Molecular Mass : | 10.2 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | QFTNDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE analysis. |
Storage : | Lyophilized recombinant human MIP-5/CCL15 (rhMIP-5/CCL15) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhMIP-5/CCL15 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | CCL15 chemokine (C-C motif) ligand 15 [ Homo sapiens ] |
Official Symbol | CCL15 |
Synonyms | CCL15; chemokine (C-C motif) ligand 15; SCYA15, small inducible cytokine subfamily A (Cys Cys), member 15; C-C motif chemokine 15; CC chemokine 3; chemokine CC 2; HCC 2; HMRP 2B; leukotactin 1; Lkn 1; macrophage inflammatory protein 5; MIP 1 delta; MIP 1d; MIP 5; NCC 3; SCYL3; MIP-1 delta; chemokine CC-2; new CC chemokine 3; small-inducible cytokine A15; small inducible cytokine subfamily A (Cys-Cys), member 15; LKN1; NCC3; SY15; HCC-2; LKN-1; MIP-5; NCC-3; MIP-1D; MRP-2B; SCYA15; HMRP-2B; |
Gene ID | 6359 |
mRNA Refseq | NM_032965 |
Protein Refseq | NP_116741 |
MIM | 601393 |
UniProt ID | Q16663 |
◆ Recombinant Proteins | ||
CCL15-070C | Active Recombinant Human CCL15 Protein (92 aa) | +Inquiry |
CCL15-1174H | Recombinant Human CCL15 Protein (Ser46-Ile113), N-GST tagged | +Inquiry |
CCL15-326C | Active Recombinant Human CCL15 Protein (92 aa) | +Inquiry |
CCL15-422H | Recombinant Human CCL15 protein | +Inquiry |
CCL15-197H | Recombinant Human CCL15 protein(Gln22-Ile113), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCL15-7731HCL | Recombinant Human CCL15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCL15 Products
Required fields are marked with *
My Review for All CCL15 Products
Required fields are marked with *
0
Inquiry Basket