Active Recombinant Human CD22 Protein, Fc-tagged, FITC conjugated
| Cat.No. : | CD22-561HF |
| Product Overview : | The FITC conjugated recombinant human CD22-Fc fusion protein is expressed as an 892 amino acid protein consisting of Asp20-Thr683 region of CD22 (UniProt accession #P20273) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
| Availability | July 29, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | Fc |
| Protein Length : | 20-683 a.a. |
| Bio-activity : | Immobilized CD22 ECD protein supports the adhesion of human red blood cells. Binds anti-CD22 monoclonal antibodies with high affinity. |
| Molecular Mass : | Calculated molecular mass: 100.2 kDa Estimated by SDS-PAGE under reducing condition: 120-130 kDa |
| AA Sequence : | DSSKWVFEHPETLYAWEGACVWIPCTYRALDGDLESFILFHNPEYNKNTSKFDGTRLYESTKDGKVPSEQKRVQF LGDKNKNCTLSIHPVHLNDSGQLGLRMESKTEKWMERIHLNVSERPFPPHIQLPPEIQESQEVTLTCLLNFSCY GYPIQLQWLLEGVPMRQAAVTSTSLTIKSVFTRSELKFSPQWSHHGKIVTCQLQDADGKFLSNDTVQLNVKHTP KLEIKVTPSDAIVREGDSVTMTCEVSSSNPEYTTVSWLKDGTSLKKQNTFTLNLREVTKDQSGKYCCQVSNDVG PGRSEEVFLQVQYAPEPSTVQILHSPAVEGSQVEFLCMSLANPLPTNYTWYHNGKEMQGRTEEKVHIPKILPWH AGTYSCVAENILGTGQRGPGAELDVQYPPKKVTTVIQNPMPIREGDTVTLSCNYNSSNPSVTRYEWKPHGAWEE PSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKE VQFFWEKNGRLLGKESQLNFDSISPEDAGSYSCWVNNSIGQTASKAWTLEVLYAPRRLRVSMSPGDQVMEGKSA TLTCESDANPPVSHYTWFDWNNQSLPYHSQKLRLEPVKVQHSGAYWCQGTNSVGKGRSPLSTLTVYYSPETSTG THTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQY NSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVK GFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLS PGK |
| Endotoxin : | < 0.1 EU/ μg of purified recombinant protein determined by the LAL method |
| Purity : | > 90 % by SDS-PAGE under reducing condition |
| Characteristic : | Disulfide-linked homodimer Labeled with FITC via amines Excitation source: 488 nm spectral line, argon-ion laser Excitation Wavelength: 488 nm Emission Wavelength: 535 nm |
| Storage : | The product is shipped at 4 centigrade. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20 centigrade for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4 centigrade for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Supplied at 0.5 mg/ml in sterile PBS pH 7.4 (carrier & preservative free). |
| Conjugation : | FITC |
| Gene Name | CD22 CD22 molecule [ Homo sapiens ] |
| Official Symbol | CD22 |
| Synonyms | CD22; CD22 molecule; CD22 antigen; B-cell receptor CD22; sialic acid binding Ig like lectin 2; SIGLEC 2; SIGLEC2; BL-CAM; T-cell surface antigen Leu-14; B-lymphocyte cell adhesion molecule; sialic acid binding Ig-like lectin 2; sialic acid-binding Ig-like lectin 2; SIGLEC-2; FLJ22814; MGC130020; |
| Gene ID | 933 |
| mRNA Refseq | NM_001185099 |
| Protein Refseq | NP_001172028 |
| MIM | 107266 |
| UniProt ID | P20273 |
| ◆ Recombinant Proteins | ||
| CD22-173H | Recombinant Human CD22 Protein, Fc\Avi-tagged | +Inquiry |
| CD22-16H | Recombinant Human CD22 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CD22-562HA | Recombinant Human CD22 protein, Fc-tagged, APC labeled | +Inquiry |
| CD22-1411H | Recombinant Human CD22 Protein (Trp176-Ala330), N-His tagged | +Inquiry |
| Cd22-535MB | Recombinant Mouse Cd22 Protein (Met1-Arg708), His tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD22-001MCL | Recombinant Mouse CD22 cell lysate | +Inquiry |
| CD22-1956HCL | Recombinant Human CD22 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD22 Products
Required fields are marked with *
My Review for All CD22 Products
Required fields are marked with *



