Active Recombinant Human CD244, His-tagged, Biotinylated

Cat.No. : CD244-683H
Product Overview : The recombinant human SLAMF4 ECD protein is expressed as a 214-amino acid protein consisting of Cys22 - Pro224 region of SLAMF4 (UniProt accession #Q9BZW8 - isoform 2) and a C-terminal His-tag. It contains 8 potential sites for N-linked glycosylation.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : His
Protein Length : 22-224 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Immobilized SLAMF4 binds heterophilically to SLAMF2/CD48 in a functional ELISA
Molecular Mass : Calculated molecular mass (kDa): 24.0; Estimated by SDS-PAGE under reducing condition (kDa): 40-50
AA Sequence : CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIK AAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSK LIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWPSTGHHHHHHHH
Endotoxin : <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">
Purity : >90% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name CD244 CD244 molecule, natural killer cell receptor 2B4 [ Homo sapiens ]
Official Symbol CD244
Synonyms CD244; CD244 molecule, natural killer cell receptor 2B4; CD244 natural killer cell receptor 2B4 , natural killer cell receptor 2B4; natural killer cell receptor 2B4; 2B4; NAIL; NKR2B4; Nmrk; SLAMF4; h2B4; NK cell activation-inducing ligand; NK cell type I receptor protein 2B4; NK cell activation inducing ligand NAIL;
Gene ID 51744
mRNA Refseq NM_001166663
Protein Refseq NP_001160135
MIM 605554
UniProt ID Q9BZW8
Chromosome Location 1q23.1
Pathway Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem;
Function protein binding; receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CD244 Products

Required fields are marked with *

My Review for All CD244 Products

Required fields are marked with *

0
cart-icon