Active Recombinant Human CD244, His-tagged, Biotinylated
| Cat.No. : | CD244-683H |
| Product Overview : | The recombinant human SLAMF4 ECD protein is expressed as a 214-amino acid protein consisting of Cys22 - Pro224 region of SLAMF4 (UniProt accession #Q9BZW8 - isoform 2) and a C-terminal His-tag. It contains 8 potential sites for N-linked glycosylation. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | His |
| Protein Length : | 22-224 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity : | Immobilized SLAMF4 binds heterophilically to SLAMF2/CD48 in a functional ELISA |
| Molecular Mass : | Calculated molecular mass (kDa): 24.0; Estimated by SDS-PAGE under reducing condition (kDa): 40-50 |
| AA Sequence : | CQGSADHVVSISGVPLQLQPNSIQTKVDSIAWKKLLPSQNGFHHILKWENGSLPSNTSNDRFSFIVKNLSLLIK AAQQQDSGLYCLEVTSISGKVQTATFQVFVFDKVEKPRLQGQGKILDRGRCQVALSCLVSRDGNVSYAWYRGSK LIQTAGNLTYLDEEVDINGTHTYTCNVSNPVSWESHTLNLTQDCQNAHQEFRFWPSTGHHHHHHHH |
| Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
| Purity : | >90% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Conjugation : | Biotin |
| Gene Name | CD244 CD244 molecule, natural killer cell receptor 2B4 [ Homo sapiens ] |
| Official Symbol | CD244 |
| Synonyms | CD244; CD244 molecule, natural killer cell receptor 2B4; CD244 natural killer cell receptor 2B4 , natural killer cell receptor 2B4; natural killer cell receptor 2B4; 2B4; NAIL; NKR2B4; Nmrk; SLAMF4; h2B4; NK cell activation-inducing ligand; NK cell type I receptor protein 2B4; NK cell activation inducing ligand NAIL; |
| Gene ID | 51744 |
| mRNA Refseq | NM_001166663 |
| Protein Refseq | NP_001160135 |
| MIM | 605554 |
| UniProt ID | Q9BZW8 |
| Chromosome Location | 1q23.1 |
| Pathway | Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; Natural killer cell mediated cytotoxicity, organism-specific biosystem; Natural killer cell mediated cytotoxicity, conserved biosystem; |
| Function | protein binding; receptor activity; |
| ◆ Recombinant Proteins | ||
| CD244-2854H | Active Recombinant Human CD244 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| CD244-2848C | Active Recombinant Cynomolgus/Rhesus macaque CD244 protein, His-Avi-tagged, Biotinylated | +Inquiry |
| CD244-1826H | Recombinant Human CD244 Protein, Avi-tagged, Biotinylated | +Inquiry |
| Cd244-1848R | Recombinant Rat Cd244 protein, His & T7-tagged | +Inquiry |
| CD244-683H | Active Recombinant Human CD244, His-tagged, Biotinylated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD244-2303HCL | Recombinant Human CD244 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD244 Products
Required fields are marked with *
My Review for All CD244 Products
Required fields are marked with *
