Active Recombinant Human CD276 Protein, Fc-tagged, Alexa Fluor 647 conjugated
Cat.No. : | CD276-542HAF647 |
Product Overview : | The Alexa Fluor 647 conjugated recombinant human B7-H3-Fc fusion is expressed as a 448 amino acid protein consisting of Leu29 - Ala248 region of B7-H3 (UniProt accession #Q5ZPR3 - isoform 2) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
Availability | September 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 29-248 a.a. |
Bio-activity : | Inhibits anti-CD3-induced proliferation of stimulated human T cells. Binds anti-B7-H3 monoclonal antibodies, human IgG1 and rabbit IgG in a functional ELISA. |
Molecular Mass : | Calculated molecular mass 49.2 kDa; estimated by SDS-PAGE under reducing condition 65-70 kDa probably due to glycosylation |
AA Sequence : | LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQ GNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEV FWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEAST GTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQ YNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLV KGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSL SPGK |
Endotoxin : | < 0.1 EU/ μg of purified recombinant protein determined by the LAL method |
Purity : | > 95 % by SDS-PAGE under reducing condition |
Characteristic : | Disulfide-linked homodimer Labeled with Alexa Fluor 647 via amines Excitation = 650 nm Emission = 668 nm |
Storage : | The product is shipped at 4 centigrade. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20 centigrade for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4 centigrade for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Supplied at 0.5 mg/ml in sterile PBS pH 7.4 (carrier free). |
Conjugation : | Alexa Fluor 647 |
Gene Name | CD276 CD276 molecule [ Homo sapiens ] |
Official Symbol | CD276 |
Synonyms | CD276; CD276 molecule; CD276 antigen; B7 H3; B7H3; B7RP 2; B7 homolog 3; costimulatory molecule; B7-H3; B7RP-2; 4Ig-B7-H3; |
Gene ID | 80381 |
mRNA Refseq | NM_001024736 |
Protein Refseq | NP_001019907 |
MIM | 605715 |
UniProt ID | Q5ZPR3 |
◆ Recombinant Proteins | ||
CD276-7674H | Recombinant Human CD276 protein, His-tagged | +Inquiry |
CD276-502H | Recombinant Human CD276 Protein (ECD) (Met1-Thr461), HIgG1 Fc-tagged, Biotinylated | +Inquiry |
CD276-756HAF488 | Active Recombinant Human CD276 Protein, Fc-tagged, Alexa Fluor 488 conjugated | +Inquiry |
CD276-183HF | Recombinant Human CD276 Protein, Fc-tagged, FITC conjugated | +Inquiry |
Cd276-219M | Recombinant Mouse Cd276 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
CD276-56H | Active Recombinant Human CD276 Protein, His&Avi tagged | +Inquiry |
CD276-57H | Active Recombinant Human CD276 Protein, His&Avi tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD276-1959HCL | Recombinant Human CD276 cell lysate | +Inquiry |
CD276-001MCL | Recombinant Mouse CD276 cell lysate | +Inquiry |
CD276-826RCL | Recombinant Rat CD276 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD276 Products
Required fields are marked with *
My Review for All CD276 Products
Required fields are marked with *