Recombinant Human CD276 Protein, Fc-tagged
Cat.No. : | CD276-600H |
Product Overview : | Recombinant human CD276 protein with Fc tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Fc |
Protein Length : | 534 |
Description : | The protein encoded by this gene belongs to the immunoglobulin superfamily, and thought to participate in the regulation of T-cell-mediated immune response. Studies show that while the transcript of this gene is ubiquitously expressed in normal tissues and solid tumors, the protein is preferentially expressed only in tumor tissues. Additionally, it was observed that the 3' UTR of this transcript contains a target site for miR29 microRNA, and there is an inverse correlation between the expression of this protein and miR29 levels, suggesting regulation of expression of this gene product by miR29. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
Form : | Lyophilized |
Molecular Mass : | 50 kDa |
AA Sequence : | MLRRRGSPGMGVHVGAALGALWFCLTGALEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTGAVEVQVPEDPVVALVGTDATLRCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFTEGRDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFPPEALWVTVGLSVCLIALLVALAFVCWRKIKQSCEEENAGAEDQDGEGEGSKTALQPLKHSDSKEDDGQEIA |
Purity : | > 98% |
Applications : | WB; ELISA; FACS; FC |
Stability : | This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use. |
Storage : | At -20 centigrade. |
Concentration : | 1 mg/mL |
Storage Buffer : | PBS (pH 7.4-7.5). Sterile-filtered colorless solution. |
Reconstitution : | Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance. |
Gene Name | CD276 CD276 molecule [ Homo sapiens (human) ] |
Official Symbol | CD276 |
Synonyms | CD276; CD276 molecule; CD276 antigen; B7 H3; B7H3; B7RP 2; B7 homolog 3; costimulatory molecule; B7-H3; B7RP-2; 4Ig-B7-H3; |
Gene ID | 80381 |
mRNA Refseq | NM_001024736 |
Protein Refseq | NP_001019907 |
MIM | 605715 |
UniProt ID | Q5ZPR3 |
◆ Recombinant Proteins | ||
CD276-2002HP | Recombinant Human CD276 protein, HIgG1 Fc-tagged, R-PE labeled | +Inquiry |
CD276-2631H | Recombinant Human CD276 Protein, His (Fc)-Avi-tagged | +Inquiry |
CD276-303HF | Recombinant Human CD276 Protein, hFc-tagged, FITC conjugated | +Inquiry |
CD276-756HAF555 | Active Recombinant Human CD276 Protein, Fc-tagged, Alexa Fluor 555 conjugated | +Inquiry |
CD276-5542C | Recombinant Chicken CD276 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD276-1959HCL | Recombinant Human CD276 cell lysate | +Inquiry |
CD276-001MCL | Recombinant Mouse CD276 cell lysate | +Inquiry |
CD276-826RCL | Recombinant Rat CD276 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CD276 Products
Required fields are marked with *
My Review for All CD276 Products
Required fields are marked with *
0
Inquiry Basket