Active Recombinant Human CD28, Fc-tagged, Biotinylated

• Cat.No.: CD28-566H
• Product Overview: The recombinant human CD28-Fc fusion is expressed as a 362-amino acid protein consisting of Asn19 - Pro152 region of CD28 (UniProt accession #P10747) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition.

Specification

• Species: Human
• Source: Human Cells
• Tag: Fc
• Protein Length: 19-152 a.a.
• Form: Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier and preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
• Bio-activity: Binds to human B7 family ligands, CD80/B7-1 and CD86/B7-2 as well as anti-CD28 monoclonal antibody, human IgG1 with high affinity (KD< 1="" nm)="" determined="" by="" elisa.="" inhibit="" il-2="" secretion="" in="" stimulated="" human="" jurkat="" t="" cell="" cells.="">
• Molecular Mass: Calculated molecular mass 40.7 kDa; estimated by SDS-PAGE under reducing condition 55-60 kDa probably due to glycosylation
• AA Sequence: NKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNE SVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPSTGTHTCPPCPAPEL LGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTV LHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWE SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
• Endotoxin: <0.1 eu per 1 μg of purified recombinant protein determined by the
• Purity: >95% judged by SDS-PAGE under reducing condition
• Storage: The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
• Conjugation: Biotin

Gene Information

• Gene Name: CD28 CD28 molecule [ Homo sapiens ]
• Official Symbol: CD28
• Synonyms: CD28; CD28 molecule; CD28 antigen (Tp44); T-cell-specific surface glycoprotein CD28; T cell specific surface glycoprotein; CD28 antigen; Tp44; MGC138290
• Gene ID: 940
• mRNA Refseq: NM_001243077
• Protein Refseq: NP_001230006
• MIM: 186760
• UniProt ID: P10747
• Chromosome Location: 2q33
• Pathway: Adaptive Immune System, organism-specific biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; CD28 co-stimulation, organism-specific biosystem; CD28 dependent PI3K/Akt signaling, organism-specific biosystem
• Function: SH3/SH2 adaptor activity; coreceptor activity; identical protein binding; protease binding; protein binding; protein homodimerization activity