Active Recombinant Human CD47 Protein, hIgG/His-tagged
Cat.No. : | CD47-14H |
Product Overview : | Recombinant human CD47 (19-141aa, 362aa), fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques. |
Availability | October 09, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | Fc&His |
Protein Length : | 19-141 |
Description : | This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene. |
Form : | Liquid |
Bio-activity : | Measured by its binding ability in a functional ELISA with Human SIRP alpha/CD172a. The ED50 range ≤ 100 ng/mL. |
Molecular Mass : | 40.9 kDa |
AA Sequence : | QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSPNE |
Endotoxin : | < 1 EU/μg of protein (determined by LAL method) |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE, Bioactivity |
Storage : | Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles. |
Concentration : | 0.5 mg/mL (determined by absorbance at 280nm) |
Storage Buffer : | Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol |
Gene Name | CD47 CD47 molecule [ Homo sapiens (human) ] |
Official Symbol | CD47 |
Synonyms | CD47; CD47 molecule; IAP; OA3; MER6; leukocyte surface antigen CD47; CD47 antigen (Rh-related antigen, integrin-associated signal transducer); CD47 glycoprotein; Rh-related antigen; antigen identified by monoclonal antibody 1D8; antigenic surface determinant protein OA3; integrin associated protein; integrin-associated signal transducer |
Gene ID | 961 |
mRNA Refseq | NM_001777 |
Protein Refseq | NP_001768 |
MIM | 601028 |
UniProt ID | Q08722 |
◆ Recombinant Proteins | ||
Cd47-645M | Active Recombinant Mouse Cd47 protein, Fc-tagged | +Inquiry |
RFL25841BF | Recombinant Full Length Bovine Leukocyte Surface Antigen Cd47(Cd47) Protein, His-Tagged | +Inquiry |
CD47-347H | Active Recombinant Human CD47 Protein, LIgG2b Fc-tagged, low endotoxin | +Inquiry |
Cd47-8767RAF488 | Recombinant Rat Cd47 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
CD47-7889H | Recombinant Human CD47, Fc tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD47-850HCL | Recombinant Human CD47 cell lysate | +Inquiry |
CD47-1363RCL | Recombinant Rat CD47 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD47 Products
Required fields are marked with *
My Review for All CD47 Products
Required fields are marked with *