Active Recombinant Human CD84, Fc-tagged
| Cat.No. : | CD84-686H |
| Product Overview : | The recombinant human SLAMF5-Fc fusion protein is expressed as a 431-amino acid protein consisting of Lys22 - Gly225 region of SLAMF5 (UniProt accession #Q9UIB8) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | Fc |
| Protein Length : | 22-225 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). |
| Bio-activity : | Immobilized SLAMF5 interacts homophilically with SLAMF5 in a functional ELISA and enhances the proliferation of PHA-stimulated T cells in the presence of anti--CD3e antibody |
| Molecular Mass : | Calculated molecular mass (kDa): 48.2; Estimated by SDS-PAGE under reducing condition (kDa): 65-75 |
| AA Sequence : | KDSEIFTVNGILGESVTFPVNIQEPRQVKIIAWTSKTSVAYVTPGDSETAPVVTVTHRNYYERIHALGPNYNLVI SDLRMEDAGDYKADINTQADPYTTTKRYNLQIYRRLGKPKITQSLMASVNSTCNVTLTCSVEKEEKNVTYNWSP LGEEGNVLQIFQTPEDQELTYTCTAQNPVSNNSDSISARQLCADIAMGFRTHHTGSTGTHTCPPCPAPELLGGP SVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQ PENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
| Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
| Purity : | >95% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Gene Name | CD84 CD84 molecule [ Homo sapiens ] |
| Official Symbol | CD84 |
| Synonyms | CD84; CD84 molecule; CD84 antigen (leukocyte antigen) , CD84 molecule; SLAM family member 5; hCD84; mCD84; SLAMF5; hly9-beta; leukocyte antigen CD84; cell surface antigen MAX.3; CD84 antigen (leukocyte antigen); leucocyte differentiation antigen CD84; leukocyte differentiation antigen CD84; signaling lymphocytic activation molecule 5; LY9B; DKFZp781E2378; |
| Gene ID | 8832 |
| mRNA Refseq | NM_001184879 |
| Protein Refseq | NP_001171808 |
| MIM | 604513 |
| UniProt ID | Q9UIB8 |
| Chromosome Location | 1q24 |
| Pathway | Cell surface interactions at the vascular wall, organism-specific biosystem; Hemostasis, organism-specific biosystem; |
| Function | receptor activity; |
| ◆ Recombinant Proteins | ||
| CD84-6744H | Recombinant Human CD84 protein, His-Avi-tagged | +Inquiry |
| CD84-1417H | Recombinant Human CD84 Protein (Ile43-Leu248), N-His tagged | +Inquiry |
| CD84-173H | Recombinant Human CD84 Protein, His-tagged | +Inquiry |
| CD84-60H | Recombinant Human CD84(Lys22-Arg220) Protein, C-6*His-Avi-tagged, Biotinylated | +Inquiry |
| CD84-0871H | Recombinant Human CD84 Protein, GST-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD84-1733MCL | Recombinant Mouse CD84 cell lysate | +Inquiry |
| CD84-1129CCL | Recombinant Cynomolgus CD84 cell lysate | +Inquiry |
| CD84-3041HCL | Recombinant Human CD84 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD84 Products
Required fields are marked with *
My Review for All CD84 Products
Required fields are marked with *



