Active Recombinant Human CD86, His-tagged, Biotinylated
Cat.No. : | CD86-583H |
Product Overview : | The recombinant human CD86 ECD protein is expressed as a 235 amino acid protein consisting of Ala24 - Pro247 region of CD86 (UniProt accession #P42081) and a C-terminal His-tag. It contains 8 potential sites for N-linked glycosylation. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | His |
Protein Length : | 24-247 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Binds human CD28 and induces IL-2 secretion by Jurkat human acute T cell leukemia cells |
Molecular Mass : | Calculated molecular mass 26.9 kDa; estimated by SDS-PAGE under reducing condition 50-60 kDa probably due to glycosylation. |
AA Sequence : | APLKIQAYFNETADLPCQFANSQNQSLSELVVFWQDQENLVLNEVYLGKEKFDSVHSKYMGRTSFDSDSWTLRL HNLQIKDKGLYQCIIHHKKPTGMIRIHQMNSELSVLANFSQPEIVPISNITENVYINLTCSSIHGYPEPKKMSV LLRTKNSTIEYDGVMQKSQDNVTELYDVSISLSVSFPDVTSNMTIFCILETDKTRLLSSPFSIELEDPQPPPDH IPSTGHHHHHHHH |
Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | CD86 CD86 molecule [ Homo sapiens ] |
Official Symbol | CD86 |
Synonyms | CD86; CD86 molecule; CD28LG2, CD86 antigen (CD28 antigen ligand 2, B7 2 antigen); T-lymphocyte activation antigen CD86; B lymphocyte antigen B7 2; B7 2; B7.2; BU63; FUN-1; CTLA-4 counter-receptor B7.2; B-lymphocyte activation antigen B7-2; CD86 antigen (CD28 antigen ligand 2, B7-2 antigen); B70; B7-2; LAB72; CD28LG2; MGC34413; |
Gene ID | 942 |
mRNA Refseq | NM_001206924 |
Protein Refseq | NP_001193853 |
MIM | 601020 |
UniProt ID | P42081 |
Chromosome Location | 3q21 |
Pathway | Adaptive Immune System, organism-specific biosystem; Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; CD28 co-stimulation, organism-specific biosystem; CD28 dependent PI3K/Akt signaling, organism-specific biosystem; |
Function | coreceptor activity; protein binding; receptor activity; |
◆ Recombinant Proteins | ||
CD86-139CAF555 | Recombinant Cynomolgus CD86 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
CD86-55HAF555 | Recombinant Human CD86 Protein, Fc/His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
CD86-0932H | Recombinant Human CD86 Protein (Met1-Pro247), C-His tagged | +Inquiry |
CD86-585H | Active Recombinant Human CD86 Protein, Fc & Avi-tagged, Biotinylated | +Inquiry |
Cd86-4087RAF488 | Recombinant Rat Cd86 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD86-2619HCL | Recombinant Human CD86 cell lysate | +Inquiry |
CD86-1013CCL | Recombinant Cynomolgus CD86 cell lysate | +Inquiry |
CD86-1971RCL | Recombinant Rat CD86 cell lysate | +Inquiry |
CD86-2598MCL | Recombinant Mouse CD86 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CD86 Products
Required fields are marked with *
My Review for All CD86 Products
Required fields are marked with *