| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
Non |
| Description : |
Granulocyte colony stimulating factor (G-CSF) is the primary extracellular regulator of granulopoiesis and regulates the production of neutrophils by stimulating proliferation and survival of specific bone marrow precursor cells and their differentiation into granulocytes. Neutrophils play a critical role in the defence against bacterial and fungal infections. G-CSF is produced by monocytes, macrophages, neutrophils, fibroblasts and endothelial cells and is capable of increasing the absolute number of circulating neutrophils and enhancing their antimicrobial function. Unlike GMCSF, the activity of G-CSF is not species specific. Additionally, G-CSF production is inducible by cytokines including TNF-alpha, IL-1, GM-CSF, IL-17 and IL-4. |
| Amino Acid Sequence : |
TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP. |
| Molecular Mass : |
G-CSF migrates as a band between 15 and 20 kDa in SDS-PAGE. This compares with the predicted molecular mass of 18.7 kDa. |
| pI : |
G-CSF separates into a number of isoforms with a pI between 5.4 and 6.0 in 2D PAGE Due to post-translational modifications, in particular glycosylation. |
| Purity : |
>95%, as determined by SDS-PAGE and visualized by silver stain. |
| Formulation : |
When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. |
| Reconstitution : |
It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
| Storage : |
Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended. |
| Activity : |
The ED50of G-CSF is typically 0.01 - 0.03 ng/ml as measured in a cell proliferation assay using a murine myeloblastic M-NFS-60 cell line. |