Active Recombinant Human Colony Stimulating Factor 3 (Granulocyte)
Cat.No. : | CSF3-142H |
Product Overview : | Recombinant Human Colony Stimulating Factor 3 (Granulocyte) encoding the human Colony Stimulating Factor 3 (Granulocyte) protein sequence (containing the signal peptide sequence, and the mature G-CSF sequence) was expressed in modifiedhuman 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Non |
Description : | Granulocyte colony stimulating factor (G-CSF) is the primary extracellular regulator of granulopoiesis and regulates the production of neutrophils by stimulating proliferation and survival of specific bone marrow precursor cells and their differentiation into granulocytes. Neutrophils play a critical role in the defence against bacterial and fungal infections. G-CSF is produced by monocytes, macrophages, neutrophils, fibroblasts and endothelial cells and is capable of increasing the absolute number of circulating neutrophils and enhancing their antimicrobial function. Unlike GMCSF, the activity of G-CSF is not species specific. Additionally, G-CSF production is inducible by cytokines including TNF-alpha, IL-1, GM-CSF, IL-17 and IL-4. |
Amino Acid Sequence : | TPLGPASSLPQSFLLKCLEQVRKIQGDGAALQEKLCATYKLCHPEELVLLGHSLGIPWAPLSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELGMAPALQPTQGAMPAFASAFQRRAGGVLVASHLQSFLEVSYRVLRHLAQP. |
Molecular Mass : | G-CSF migrates as a band between 15 and 20 kDa in SDS-PAGE. This compares with the predicted molecular mass of 18.7 kDa. |
pI : | G-CSF separates into a number of isoforms with a pI between 5.4 and 6.0 in 2D PAGE Due to post-translational modifications, in particular glycosylation. |
Purity : | >95%, as determined by SDS-PAGE and visualized by silver stain. |
Formulation : | When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. |
Reconstitution : | It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
Storage : | Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended. |
Activity : | The ED50of G-CSF is typically 0.01 - 0.03 ng/ml as measured in a cell proliferation assay using a murine myeloblastic M-NFS-60 cell line. |
Gene Name | CSF3 colony stimulating factor 3 (granulocyte) [ Homo sapiens ] |
Synonyms | CSF3; colony stimulating factor 3 (granulocyte); GCSF; G-CSF; MGC45931; colony stimulating factor 3; filgrastim; lenograstim; pluripoietin; granulocyte colony stimulating factor; Granulocyte colony-sti mulating factor; OTTHUMP00000164327 |
Gene ID | 1440 |
mRNA Refseq | NM_000759 |
Protein Refseq | NP_000750 |
UniProt ID | P09919 |
Chromosome Location | q11.2-q12 |
MIM | 138970 |
Pathway | Cytokine-cytokine receptor interaction; opoietic cell lineage; Jak-STAT signaling pathway |
Function | cytokine activity; enzyme binding; granulocyte colony-stimulating factor receptor binding; growth factor activity |
◆ Recombinant Proteins | ||
CSF3-7741H | Recombinant Human CSF3 protein | +Inquiry |
CSF3-600H | Active Recombinant Human CSF3 Protein | +Inquiry |
CSF3-272H | Active Recombinant Human Colony Stimulating Factor 3 (granulocyte) | +Inquiry |
CSF3-134H | Active Recombinant Human CSF3 Protein | +Inquiry |
CSF3-1757H | Recombinant Human CSF3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CSF3-2948HCL | Recombinant Human CSF3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSF3 Products
Required fields are marked with *
My Review for All CSF3 Products
Required fields are marked with *
0
Inquiry Basket