Active Recombinant Human CXCL12, biotinylated

Cat.No. : CXCL12-133H
Product Overview : Recombinant human CXCL12a is produced in E. coli, biotinylated. Biotinylated enzymatically at the last lysine in the sequence.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : CXCL12a and CXCL12b, also known as Stromal Cell-Derived Factor 1α and 1β (SDF-1α and SDF-1β), are small cytokines that belong to the intercrine family. Both forms of CXCL12 are produced by alternate splicing of the same gene.
Form : Lyophilized.
Bio-activity : EC50 = 2.5nm determined by Calcium Flux with recombinant human CXCR4 cells. Migration confirmed with U937 cells expressing CXCR4.
Molecular Mass : 10.4kDa by Mass Spec.
AA Sequence : KPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKKLGSGLN DIFEAQKIEWHE
Endotoxin : <0.01 EU per 1ug of protein by LAL method.
Purity : >97% by SDS-PAGE
Storage : 12 months from date of receipt, -20°C to -70°C, as supplied. 1 month, 2°C to 8°C, under sterile conditions after reconstitution. 3 months, -20°C to -70°C, under sterile conditions after reconstitution.
Reconstitution : Recommended at 100ug/ml in sterile distilled water.
Gene Name CXCL12 chemokine (C-X-C motif) ligand 12 [ Homo sapiens ]
Official Symbol CXCL12
Synonyms CXCL12; chemokine (C-X-C motif) ligand 12 (stromal cell-derived factor 1); SF; SCYB12; SDF-1a; SDF-1b; SDF1; SDF-1; SDF1A; SDF1B; TLSF; TLSF-a; TLSF-b; TPAR1; C-X-C motif chemokine 12; Pre-B cell growth-stimulating factor; Stromal cell-derived factor 1 precursor; tromal cell-derived factor 1; stromal cell-derived factor 1 delta; stromal cell-derived factor 1 gamma; stromal cell-derived factor 1a
Gene ID 6387
mRNA Refseq NM_199168
Protein Refseq NP_954637
MIM 600835
UniProt ID P48061
Chromosome Location 10q11
Pathway CXCR4-mediated signaling events; Chemokine receptors bind chemokines; Chemokine signaling pathway; Class A/1 (Rhodopsin-like receptors); G alpha (i) signalling events; GPCR downstream signaling; HIF-1-alpha transcription factor network;
Function chemokine activity; emokine activity; growth factor activity; signal transducer activity; receptor binding; CXCR chemokine receptor binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL12 Products

Required fields are marked with *

My Review for All CXCL12 Products

Required fields are marked with *

0
cart-icon