Active Recombinant Human CXCL5 Protein (9-78, 70 aa)

Cat.No. : CXCL5-424C
Product Overview : Recombinant human ENA-78/CXCL5 (9-78a.a.) produced in E. coli is a single non-glycosylated polypeptide chain containing 70 amino acids. A fully biologically active molecule, rhENA-78/CXCL5 (9-78a.a.) has a molecular mass of 7.7 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 70
Description : Epithelial cell­derived neutrophil­activating peptide (ENA­78) also known as C-X-C motif chemokine 5(CXCL5), is a small cytokine belonging to the CXC chemokine family. It is produced following stimulation of cells with the inflammatory cytokines interleukin-1 or tumor necrosis factor-alpha. Expression of CXCL5 has also been observed in eosinophils, and can be inhibited with the type II interferon, IFN-γ. This chemokine stimulates the chemotaxis of neutrophils possessing angiogenic properties Full length CXCL5 (78 a.a.) is cleaved at the N­terminal end by cathepsin G and chymotrypsin to ENA-74 (74 a.a.) and ENA-70 (70a.a.), with the shortened forms showing increased potency relative to full length CXCL5. CXCL5can signal through the CXCR2 receptor.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : The EC50 value of human ENA78/CXCL5 (9-78 a.a.) on Ca^2+ mobilization assay in CHO-K1/Gα15/hCXCR2 cells (human Gα15 and human CXCR2 stably expressed in CHO-K1 cells) is less than 50 ng/mL.
Molecular Mass : 7.7 kDa, observed by reducing SDS-PAGE.
AA Sequence : RELRCVCLQTTQGVHPKMISNLQVFAIGPQCSKVEVVASLKNGKEICLDPEAPFLKKVIQKILDGGNKEN
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant human ENA78/CXCL5 (9-78a.a.) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, human ENA78/CXCL5(9-78) should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name CXCL5 chemokine (C-X-C motif) ligand 5 [ Homo sapiens ]
Official Symbol CXCL5
Synonyms CXCL5; chemokine (C-X-C motif) ligand 5; SCYB5, small inducible cytokine subfamily B (Cys X Cys), member 5 (epithelial derived neutrophil activating peptide 78); C-X-C motif chemokine 5; ENA 78; ENA-78(1-78); small inducible cytokine B5; small-inducible cytokine B5; neutrophil-activating protein 78; neutrophil-activating peptide ENA-78; epithelial-derived neutrophil activating protein 78; epithelial-derived neutrophil-activating peptide 78; epithelial-derived neutrophil-activating protein 78; small inducible cytokine subfamily B (Cys-X-Cys), member 5 (epithelial-derived neutrophil-activating peptide 78); SCYB5; ENA-78;
Gene ID 6374
mRNA Refseq NM_002994
Protein Refseq NP_002985
MIM 600324
UniProt ID P42830

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL5 Products

Required fields are marked with *

My Review for All CXCL5 Products

Required fields are marked with *

0
cart-icon