Active Recombinant Human DPP4, His tagged
| Cat.No. : | DPP4-8313H |
| Product Overview : | DPPIV Human Recombinant produced in High-5 cells is a single, glycosylated polypeptide chain containing 746 amino acids (39-766) and having a molecular mass of 86.4 kDa.DPPIV is fused to His Tag at C-terminus and purified using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Hi-5 Insect Cells |
| Tag : | His |
| Protein Length : | 39-766 a.a. |
| Description : | The protein encoded by this gene is identical to adenosine deaminase complexing protein-2, and to the T-cell activation antigen CD26. It is an intrinsic membrane glycoprotein and a serine exopeptidase that cleaves X-proline dipeptides from the N-terminus of polypeptides. |
| Form : | DPP4 is formulated in 20 mM Tris-HCl buffer pH-8, 100mM NaCl, 1mM EDTA and 10% glycerol. |
| Bio-activity : | >20 Units/mg. |
| AA Sequence : | ADP-SRKTYTLTDYLKNTYRLKLYSLRWISDHEYLYKQENNILVFNAEYGNSSVFLENSTFDEFGHSINDYSISP DGQFILLEYNYVKQWRHSYTASYDIYDLNKRQLITEERIPNNTQWVTWSPVGHKLAYVWNNDIYVKIEPNLPSYR ITWTGKEDIIYNGITDWVYEEEVFSAYSALWWSPNGTFLAYAQFNDTEVPLIEYSFYSDESLQYPKTVRVPYPKA GAVNPTVKFFVVNTDSLSSVTNATSIQITAPASMLIGDHYLCDVTWATQERISLQWLRRIQNYSVMDICDYDESS GRWNCLVARQHIEMSTTGWVGRFRPSEPHFTLDGNSFYKIISNEEGYRHICYFQIDKKDCTFITKGTWEVIGIEA LTSDYLYYISNEYKGMPGGRNLYKIQLSDYTKVTCLSCELNPERCQYYSVSFSKEAKYYQLRCSGPGLPLYTLHS SVNDKGLRVLEDNSALDKMLQNVQMPSKKLDFIILNETKFWYQMILPPHFDKSKKYPLLLDVYAGPCSQKADTVF RLNWATYLASTENIIVASFDGRGSGYQGDKIMHAINRRLGTFEVEDQIEAARQFSKMGFVDNKRIAIWGWSYGGY VTSMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADD NVHFQQSAQISKALVDVGVDFQAMWYTDEDHGIASSTAHQHIYTHMSHFIKQCFSLP-SGRLVPRGSHHHHHH. |
| Purity : | Greater than 95.0% as determined by Analysis by SDS-PAGE.On SDS-PAGE under denatured condition, apparent molecular weight of glycosylated DPP4 will migrate at approximately 90kDa. |
| Applications : | Unit Definition One unit will hydrolyze mmole of p-nitroaniline per minute at pH8.0 at 37℃ using 1mM of Gly-Pro p-nitroanilde as substrate. |
| Notes : | For research use only. |
| Storage : | DPP4 although stable 4 ℃ for weeks, should be stored desiccated below -18 ℃. For long term storage it is recommended to add carrier protein (0. 1% HSA or BSA). Please prevent freeze/thaw cycles. |
| Gene Name | DPP4 dipeptidyl-peptidase 4 [ Homo sapiens ] |
| Official Symbol | DPP4 |
| Synonyms | DPP4; dipeptidyl-peptidase 4; ADCP2, adenosine deaminase complexing protein 2 , CD26, dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2); dipeptidyl peptidase 4; DPPIV; ADCP-2; DPP IV; dipeptidylpeptidase 4; dipeptidyl peptidase IV; T-cell activation antigen CD26; adenosine deaminase complexing protein 2; dipeptidylpeptidase IV (CD26, adenosine deaminase complexing protein 2); CD26; ADABP; ADCP2; TP103; |
| Gene ID | 1803 |
| mRNA Refseq | NM_001935 |
| Protein Refseq | NP_001926 |
| MIM | 102720 |
| UniProt ID | P27487 |
| Chromosome Location | 2q23-qter |
| Pathway | Incretin Synthesis, Secretion, and Inactivation, organism-specific biosystem; Integration of energy metabolism, organism-specific biosystem; Metabolism, organism-specific biosystem; Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem; Regulation of Insulin Secretion, organism-specific biosystem; Synthesis, Secretion, and Inactivation of Glucagon-like Peptide-1 (GLP-1), organism-specific biosystem; |
| Function | aminopeptidase activity; collagen binding; dipeptidyl-peptidase activity; peptidase activity; peptide binding; protease binding; protein binding; protein homodimerization activity; receptor activity; receptor binding; serine-type endopeptidase activity; serine-type peptidase activity; |
| ◆ Recombinant Proteins | ||
| DPP4-4063H | Recombinant Human DPP4 protein, His-tagged | +Inquiry |
| DPP4-5830H | Recombinant Human DPP4 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Dpp4-2369M | Recombinant Mouse Dpp4 protein, His-SUMO-tagged | +Inquiry |
| DPP4-3739H | Human 1PFQ | +Inquiry |
| DPP4-608H | Active Recombinant Human DPP4 Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| DPP4-197H | Native Human Dipeptidyl Peptidase IV | +Inquiry |
| DPP4-31H | Active Native Human DPP4 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DPP4-733CCL | Recombinant Cynomolgus DPP4 cell lysate | +Inquiry |
| DPP4-2979HCL | Recombinant Human DPP4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DPP4 Products
Required fields are marked with *
My Review for All DPP4 Products
Required fields are marked with *
