Active Recombinant Human EIF4G1 protein, Myc/DDK-tagged

Cat.No. : EIF4G1-01H
Product Overview : Recombinant Human EIF4G1 protein, fused to Myc/DDK-tagged, was expressed in HEK293T. Protein Pathways: Viral myocarditis
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a component of the multi-subunit protein complex EIF4F. This complex facilitates the recruitment of mRNA to the ribosome, which is a rate-limiting step during the initiation phase of protein synthesis. The recognition of the mRNA cap and the ATP-dependent unwinding of 5'-terminal secondary structure is catalyzed by factors in this complex. The subunit encoded by this gene is a large scaffolding protein that contains binding sites for other members of the EIF4F complex. A domain at its N-terminus can also interact with the poly(A)-binding protein, which may mediate the circularization of mRNA during translation. Alternative splicing results in multiple transcript variants, some of which are derived from alternative promoter usage.
Form : 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
Bio-activity : In vitro translation assay
Molecular Mass : 154.6 kDa
AA Sequence : myc-FLAG tag
Product-Related Proteins : TA50011-100
LC417630
RC212877
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Usage : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL
Gene Name EIF4G1 eukaryotic translation initiation factor 4 gamma 1 [ Homo sapiens (human) ]
Official Symbol EIF4G1
Synonyms EIF-4G1; EIF4F; EIF4G; EIF4GI; P220; PARK18
Gene ID 1981
mRNA Refseq NM_004953
Protein Refseq NP_004944
MIM 600495
UniProt ID Q04637

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All EIF4G1 Products

Required fields are marked with *

My Review for All EIF4G1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon