Active Recombinant Human FCGR2A Protein, His tagged

• Cat.No.: FCGR2A-03H
• Product Overview: Recombinant human Fc gamma RIIA/CD32a (30-218 aa), fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: 30-218 aa
• Description: This gene encodes one member of a family of immunoglobulin Fc receptor genes found on the surface of many immune response cells. The protein encoded by this gene is a cell surface receptor found on phagocytic cells such as macrophages and neutrophils, and is involved in the process of phagocytosis and clearing of immune complexes. Alternative splicing results in multiple transcript variants.
• Form: Liquid
• AASequence: SADSQAAAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSRLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVTITVQVPSMGSSSPMGI
• Molecular Mass: 21.7 kDa
• Bio-activity: Measured by its binding ability in a functional ELISA with Human IgG.
• Endotoxin: < 1 EU/μg of protein determined by LAL method
• Purity: > 95% by SDS-PAGE
• Application: SDS-PAGE, Bioactivity
• Note: For research use only. This product is not intended or approved for human, diagnostics or veterinary use.
• Storage: Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
• Storage Buffer: Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol.
• Concentration: 1 mg/mL (determined by Absorbance at 280nm)

Gene Information

• Gene Name: FCGR2A Fc gamma receptor IIa [ Homo sapiens (human) ]
• Official Symbol: FCGR2A
• Synonyms: FCGR2A; Fc gamma receptor IIa; CD32; FCG2; FcGR; CD32A; CDw32; FCGR2; IGFR2; FCGR2A1; FcgammaRIIa; low affinity immunoglobulin gamma Fc region receptor II-a; Fc fragment of IgG receptor IIa; Fc fragment of IgG, low affinity IIa, receptor (CD32); Fc gamma receptor RIIa3; Immunoglobulin G Fc receptor II; fc-gamma-RIIa; fcRII-a; igG Fc receptor II-a
• Gene ID: 2212
• mRNA Refseq: NM_021642
• Protein Refseq: NP_067674
• MIM: 146790
• UniProt ID: P12318