Active Recombinant Human FGF18 Protein (174 aa)

• Cat.No.: FGF18-418F
• Product Overview: Recombinant human Fibroblast Growth Factor-18 (rhFGF-18) produced in E. coli is a single non-glycosylated polypeptide chain containing 174 amino acids. A fully biologically active molecule, rhFGF-18 has a molecular mass of 20.3 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 174
• Description: Fibroblast Growth Factor-18 (FGF-18) is a heparin-binding growth factor that is a member of the FGF family. FGF-18 signals through FGFR 1c, 2c, 3c, and 4. FGF-18 plays an important role in the regulation of cell proliferation, cell differentiation and cell migration. FGF-18 is required for normal ossification and bone development. It can also stimulate hepatic and intestinal proliferation.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 10 ng/mL, measured by a cell proliferation assay using 3T3 Cells, corresponding to a specific activity of > 1.0 × 10^5units/mg.
• Molecular Mass: 20.3 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSR
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% by SDS-PAGE and HPLC analyses.
• Storage: Lyophilized recombinant human Fibroblast Growth Factor-18 (rhFGF-18) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhFGF-18 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: FGF18 fibroblast growth factor 18 [ Homo sapiens ]
• Official Symbol: FGF18
• Synonyms: FGF18; fibroblast growth factor 18; FGF 18; ZFGF5; FGF-18
• Gene ID: 8817
• mRNA Refseq: NM_003862
• Protein Refseq: NP_003853
• MIM: 603726
• UniProt ID: O76093