Active Recombinant Human FGF18 Protein (174 aa)

Cat.No. : FGF18-418F
Product Overview : Recombinant human Fibroblast Growth Factor-18 (rhFGF-18) produced in E. coli is a single non-glycosylated polypeptide chain containing 174 amino acids. A fully biologically active molecule, rhFGF-18 has a molecular mass of 20.3 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 174
Description : Fibroblast Growth Factor-18 (FGF-18) is a heparin-binding growth factor that is a member of the FGF family. FGF-18 signals through FGFR 1c, 2c, 3c, and 4. FGF-18 plays an important role in the regulation of cell proliferation, cell differentiation and cell migration. FGF-18 is required for normal ossification and bone development. It can also stimulate hepatic and intestinal proliferation.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 10 ng/mL, measured by a cell proliferation assay using 3T3 Cells, corresponding to a specific activity of > 1.0 × 10^5units/mg.
Molecular Mass : 20.3 kDa, observed by reducing SDS-PAGE.
AA Sequence : MAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGKHIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECVFIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQPELQKPFKYTTVTKRSR
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analyses.
Storage : Lyophilized recombinant human Fibroblast Growth Factor-18 (rhFGF-18) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhFGF-18 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name FGF18 fibroblast growth factor 18 [ Homo sapiens ]
Official Symbol FGF18
Synonyms FGF18; fibroblast growth factor 18; FGF 18; ZFGF5; FGF-18;
Gene ID 8817
mRNA Refseq NM_003862
Protein Refseq NP_003853
MIM 603726
UniProt ID O76093

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FGF18 Products

Required fields are marked with *

My Review for All FGF18 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon