Active Recombinant Human FGF5 Protein
Cat.No. : | FGF5-89H |
Product Overview : | Recombinant Human FGF5 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Fibroblast growth factor 5 (FGF-5) is a secreted heparin-binding growth factor that binds to FGF receptors 1 and 2 (FGFR1 and FGFR2). FGF-5 is expressed in the mesenchyme, skeletal muscles, central nervous system, and hair follicles to promote cell differentiation and proliferation. FGF-5 functions as a regulatory factor during hair elongation and skeletal muscle development. |
Bio-activity : | 3T3 Proliferation w 1 ug heparin, ≤10 ng/mL; ≥1.0 x 10^5 units/mg |
Molecular Mass : | Monomer, 27.7 kDa (252 aa) |
AA Sequence : | MAWAHGEKRLAPKGQPGPAATDRNPIGSSSRQSSSSAMSSSSASSSPAASLGSQGSGLEQSSFQWSPSGRRTGSLYCRVGIGFHLQIYPDGKVNGSHEANMLSVLEIFAVSQGIVGIRGVFSNKFLAMSKKGKLHASAKFTDDCKFRERFQENSYNTYASAIHRTEKTGREWYVALNKRGKAKRGCSPRVKPQHISTHFLPRFKQSEQPELSFTVTVPEKKNPPSPIKSKIPLSAPRKNTNSVKYRLKFRFG |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate and 100 mM sodium chloride, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | FGF5 fibroblast growth factor 5 [ Homo sapiens (human) ] |
Official Symbol | FGF5 |
Synonyms | FGF5; fibroblast growth factor 5; heparin-binding growth factor 5; HBGF-5; Smag-82; |
Gene ID | 2250 |
mRNA Refseq | NM_004464 |
Protein Refseq | NP_004455 |
MIM | 165190 |
UniProt ID | P12034 |
◆ Recombinant Proteins | ||
FGF5-2334R | Recombinant Rat FGF5 Protein | +Inquiry |
FGF5-1951Z | Recombinant Zebrafish FGF5 | +Inquiry |
FGF5-89H | Active Recombinant Human FGF5 Protein | +Inquiry |
FGF5-4835HF | Recombinant Full Length Human FGF5 Protein, GST-tagged | +Inquiry |
FGF5-4114H | Recombinant Human FGF5 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF5-6238HCL | Recombinant Human FGF5 293 Cell Lysate | +Inquiry |
FGF5-6239HCL | Recombinant Human FGF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FGF5 Products
Required fields are marked with *
My Review for All FGF5 Products
Required fields are marked with *