Species : |
Human |
Source : |
E.coli |
Tag : |
Non |
Description : |
Human KGF-1 also known as Fibroblast growth factor 7 (FGF-7), is encoded by the FGF7 gene. KGF-1 only binds to the b splice form of the tyrosine kinase receptor, FGFR2b KGFR. Affinity between KGF-1 and its receptor can be increased by heparin or heparan sulfate proteoglycan. FGF-10, also called keratinocyte growth factor 2 (KGF-2), shares 51 % amino acid sequence identity and similar function to KGF-1, but uses an additional receptor, FGFR2c. KGF-1 plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. KGF-1 actives on keratinocytes, and exhibits mitogenic activity for epidermal cells, but essentially no activity for fibroblasts. KGF-1 has species crossactive, human KGF-1 shares 96 % amino acid sequence identity with murine, and 92 % with rat. |
Form : |
Sterile Filtered White lyophil |
Bio-activity : |
Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 10 ng/mL, corresponding to a specific activity of > 1.0×10^5 IU/mg. |
Molecular Mass : |
Approximately 18.9 kDa |
AA Sequence : |
CNDMTPEQMATNVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNNYNIMEIRTVAVGIVAIKGVESEFYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHNGGEMFVALNQKGIPVRGKKTKKEQKTAHFLPMAIT |
Endotoxin : |
Less than 1 EU/μg of rHuKGF-1/FGF-7 as determined by LAL method. |
Purity : |
> 96% by SDS-PAGE and HPLC analyses. |
Storage : |
This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze thaw cycles. |
Storage Buffer : |
Lyophilized from a 0.2 μm filtered solution in 20 mM PB, 0.5 M NaCl, pH 8.0. |
Reconstitution : |
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. |