Active Recombinant Human FLT1, Fc-tagged, Biotinylated

Cat.No. : FLT1-615H
Product Overview : The recombinant human FLT1-Fc fusion is expressed as a 859 amino acid protein consisting of Ser27 - Arg656 region of FLT1 (Uniprot accession # P17948 - isoform 2 or soluble FLT1) and a C-terminal Fc from human IgG1, which exists as a dimer under non-reducing conditions.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Human Cells
Tag : Fc
Protein Length : 27-656 a.a.
Form : Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule).
Bio-activity : Binds VEGF and inhibits VEGF-dependent proliferation of human umbilical vein endothelial cells (HUVEC)
Molecular Mass : Calculated molecular mass (kDa): 96.9; Estimated by SDS-PAGE under reducing condition (kDa): 110-120
AA Sequence : SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQAN HTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPL DTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTL VLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSV NTSVHIYDKAFITVKHRKQQVLETVAGKRSYRLSMKVKAFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVT EEDAGNYTILLSIKQSNVFKNLTATLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWH PCNHNHSEARCDFCSNNEESFILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNKVGT VGRNISFYITDVPNGFHVNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTMHYSISKQKMAITKEHSI TLNLTIMNVSLQDSGTYACRARNVYTGEEILQKKEITIRGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMI SRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKA LPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDS DGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
Endotoxin : <0.1 eu per 1 μg of purified recombinant protein determined by the
Purity : >95% judged by SDS-PAGE under reducing condition
Storage : The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles.
Gene Name FLT1 fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor) [ Homo sapiens ]
Official Symbol FLT1
Synonyms FLT1; fms-related tyrosine kinase 1 (vascular endothelial growth factor/vascular permeability factor receptor); FLT; vascular endothelial growth factor receptor 1; VEGFR1; FLT-1; VEGFR-1; fms-like tyrosine kinase 1; tyrosine-protein kinase FRT; tyrosine-protein kinase receptor FLT; vascular permeability factor receptor;
Gene ID 2321
mRNA Refseq NM_001159920
Protein Refseq NP_001153392
MIM 165070
UniProt ID P17948
Chromosome Location 13q12
Pathway Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Endocytosis, organism-specific biosystem; Endocytosis, conserved biosystem; Focal Adhesion, organism-specific biosystem; Focal adhesion, organism-specific biosystem; Focal adhesion, conserved biosystem;
Function ATP binding; growth factor binding; nucleotide binding; protein binding; receptor activity; transmembrane receptor protein tyrosine kinase activity; vascular endothelial growth factor-activated receptor activity; vascular endothelial growth factor-activated receptor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FLT1 Products

Required fields are marked with *

My Review for All FLT1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon