Active Recombinant Human FLT3L protein

Cat.No. : FLT3LG-25H
Product Overview : Recombinant Human FLT3L (27–181 of P49771-1 FLT3L_HUMAN) protein expressed in Nicotiana benthamiana. It is produced by transient expression in non-transgenic plants and is purified by sequential chromatography (FPLC). This product contains no animal–derived components or impurities.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Nicotiana Benthamiana
Tag : Non
Protein Length : 28-181 a.a.
Form : Lyophilized from a Tris HCl 0.05M buffer pH 7.4.
Bio-activity : The activity of Flt-3 is determinated by the dose-dependent stimulation of the proliferation of human acute myeloid leukemia cells (OCMI-AML5). ED50 is typically ≤ 1 ng/ml.
Molecular Mass : It has a predicted molecular mass of 18.4 kDa, however as result of potential glycosylation, the recombinant protein could migrate with an apparent molecular mass of 18-25 kDa in SDS-PAGE.
AA Sequence : HHHHHHTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQ GLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWS PRPLEATAPTA
Endotoxin : 1 EU/µg determined by LAL method
Purity : >95 % as determined by SDS-PAGE analysis
Applications : BIOASSAY, SDS-PAGE, WB.
Storage : Frozen / Solution. For extended storage, conserve at −80ºC. Repeated freezing and thawing is not recommended. Store working aliquots at 4ºC for up to one week.
Reconstitution : Lyophilized protein should be reconstituted in water to a concentration of 50 ng/μl. Optimal concentration should be determined for specific application and cell lines.
Gene Name FLT3LG fms-related tyrosine kinase 3 ligand [ Homo sapiens ]
Official Symbol FLT3LG
Synonyms FLT3LG; fms-related tyrosine kinase 3 ligand; FL; Flt3 ligand
Gene ID 2323
mRNA Refseq NM_001459
Protein Refseq NP_001450
MIM 600007
UniProt ID P49771
Chromosome Location 19q13.3
Pathway Cytokine-cytokine receptor interaction; atopoietic cell lineage; Pathways in cancer
Function cytokine activity; protein homodimerization activity; receptor tyrosine kinase binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FLT3LG Products

Required fields are marked with *

My Review for All FLT3LG Products

Required fields are marked with *

0
cart-icon
0
compare icon