Active Recombinant Human FLT3L protein

• Cat.No.: FLT3LG-25H
• Product Overview: Recombinant Human FLT3L (27–181 of P49771-1 FLT3L_HUMAN) protein expressed in Nicotiana benthamiana. It is produced by transient expression in non-transgenic plants and is purified by sequential chromatography (FPLC). This product contains no animal–derived components or impurities.

Specification

• Species: Human
• Source: Nicotiana Benthamiana
• Tag: Non
• Protein Length: 28-181 a.a.
• Form: Lyophilized from a Tris HCl 0.05M buffer pH 7.4.
• Bio-activity: The activity of Flt-3 is determinated by the dose-dependent stimulation of the proliferation of human acute myeloid leukemia cells (OCMI-AML5). ED50 is typically ≤ 1 ng/ml.
• Molecular Mass: It has a predicted molecular mass of 18.4 kDa, however as result of potential glycosylation, the recombinant protein could migrate with an apparent molecular mass of 18-25 kDa in SDS-PAGE.
• AA Sequence: HHHHHHTQDCSFQHSPISSDFAVKIRELSDYLLQDYPVTVASNLQDEELCGGLWRLVLAQRWMERLKTVAGSKMQ GLLERVNTEIHFVTKCAFQPPPSCLRFVQTNISRLLQETSEQLVALKPWITRQNFSRCLELQCQPDSSTLPPPWS PRPLEATAPTA
• Endotoxin: 1 EU/µg determined by LAL method
• Purity: >95 % as determined by SDS-PAGE analysis
• Applications: BIOASSAY, SDS-PAGE, WB.
• Storage: Frozen / Solution. For extended storage, conserve at −80ºC. Repeated freezing and thawing is not recommended. Store working aliquots at 4ºC for up to one week.
• Reconstitution: Lyophilized protein should be reconstituted in water to a concentration of 50 ng/μl. Optimal concentration should be determined for specific application and cell lines.

Gene Information

• Gene Name: FLT3LG fms-related tyrosine kinase 3 ligand [ Homo sapiens ]
• Official Symbol: FLT3LG
• Synonyms: FLT3LG; fms-related tyrosine kinase 3 ligand; FL; Flt3 ligand
• Gene ID: 2323
• mRNA Refseq: NM_001459
• Protein Refseq: NP_001450
• MIM: 600007
• UniProt ID: P49771
• Chromosome Location: 19q13.3
• Pathway: Cytokine-cytokine receptor interaction; atopoietic cell lineage; Pathways in cancer
• Function: cytokine activity; protein homodimerization activity; receptor tyrosine kinase binding