Active Recombinant Human FUT5 Protein (AA 40-374), N-6×His/GFP tagged

Cat.No. : FUT5-25H
Product Overview : Recombinant Human FUT5 Protein (AA 40-374) with N-6×His/GFP tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : GFP&His
Protein Length : AA 40-374
Description : Enables 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity and 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity. Involved in ceramide metabolic process and oligosaccharide metabolic process. Predicted to be located in Golgi membrane.
Bio-activity : ≥0.05 μmol/min/mg, as measured under the conditions with LNnT
Molecular Mass : ~70-75 kDa
AA Sequence : DATGSPRPGLMAVEPVTGAPNGSRCQDSMATPAHPTLLILLWTWPFNTPVALPRCSEMVPGAADCNITADSSVYPQADAVIVHHWDIMYNPSANLPPPTRPQGQRWIWFSMESPSNCRHLEALDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKPDSARRYYQSLQAHLKVDVYGRSHKPLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFHVDDFQSPKDLARYLQELDKDHARYLSYFHWRETLRPRSFSWALAFCKACWKLQQESRYQTVRSIAAWFT
Purity : >95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain.
Stability : 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
Concentration : 1 mg/mL
Storage Buffer : Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol.
Preservative : 0.05 % NaN3
Shipping : This product is shipped as 0.2μm filtered product on dry ice.
Gene Name FUT5 fucosyltransferase 5 (alpha (1,3) fucosyltransferase) [ Homo sapiens (human) ]
Official Symbol FUT5
Synonyms FUT5; fucosyltransferase 5 (alpha (1,3) fucosyltransferase); alpha-(1,3)-fucosyltransferase; FUC TV; fucT-V; fucosyltransferase V; alpha (1,3) fucosyltransferase; galactoside 3-L-fucosyltransferase; FUC-TV;
Gene ID 2527
mRNA Refseq NM_002034
Protein Refseq NP_002025
MIM 136835
UniProt ID Q11128

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FUT5 Products

Required fields are marked with *

My Review for All FUT5 Products

Required fields are marked with *

0
cart-icon
0
compare icon