Active Recombinant Human FUT5 Protein (AA 40-374), N-6×His/GFP tagged

• Cat.No.: FUT5-25H
• Product Overview: Recombinant Human FUT5 Protein (AA 40-374) with N-6×His/GFP tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: GFP&His
• Protein Length: AA 40-374
• Description: Enables 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity and 4-galactosyl-N-acetylglucosaminide 3-alpha-L-fucosyltransferase activity. Involved in ceramide metabolic process and oligosaccharide metabolic process. Predicted to be located in Golgi membrane.
• Bio-activity: ≥0.05 μmol/min/mg, as measured under the conditions with LNnT
• Molecular Mass: ~70-75 kDa
• AA Sequence: DATGSPRPGLMAVEPVTGAPNGSRCQDSMATPAHPTLLILLWTWPFNTPVALPRCSEMVPGAADCNITADSSVYPQADAVIVHHWDIMYNPSANLPPPTRPQGQRWIWFSMESPSNCRHLEALDGYFNLTMSYRSDSDIFTPYGWLEPWSGQPAHPPLNLSAKTELVAWAVSNWKPDSARRYYQSLQAHLKVDVYGRSHKPLPKGTMMETLSRYKFYLAFENSLHPDYITEKLWRNALEAWAVPVVLGPSRSNYERFLPPDAFHVDDFQSPKDLARYLQELDKDHARYLSYFHWRETLRPRSFSWALAFCKACWKLQQESRYQTVRSIAAWFT
• Purity: >95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain.
• Stability: 6 months if stored at -80 centigrade. Avoid repeated freeze thaws.
• Concentration: 1 mg/mL
• Storage Buffer: Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol.
• Preservative: 0.05 % NaN3
• Shipping: This product is shipped as 0.2μm filtered product on dry ice.

Gene Information

• Gene Name: FUT5 fucosyltransferase 5 (alpha (1,3) fucosyltransferase) [ Homo sapiens (human) ]
• Official Symbol: FUT5
• Synonyms: FUT5; fucosyltransferase 5 (alpha (1,3) fucosyltransferase); alpha-(1,3)-fucosyltransferase; FUC TV; fucT-V; fucosyltransferase V; alpha (1,3) fucosyltransferase; galactoside 3-L-fucosyltransferase; FUC-TV
• Gene ID: 2527
• mRNA Refseq: NM_002034
• Protein Refseq: NP_002025
• MIM: 136835
• UniProt ID: Q11128