Recombinant Human FUT5 Protein, GST-tagged

Cat.No. : FUT5-4564H
Product Overview : Human FUT5 partial ORF ( NP_002025, 95 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : FUT5 (Fucosyltransferase 5) is a Protein Coding gene. Among its related pathways are Metabolism and Glycosphingolipid biosynthesis - lacto and neolacto series. GO annotations related to this gene include fucosyltransferase activity and 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity. An important paralog of this gene is FUT3.
Molecular Mass : 33.44 kDa
AA Sequence : SEMVPGAADCNITADSSVYPQADAVIVHHWDIMYNPSANLPPPTRPQGQRWIWFSMESPSNCRHLEALDG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name FUT5 fucosyltransferase 5 (alpha (1,3) fucosyltransferase) [ Homo sapiens ]
Official Symbol FUT5
Synonyms FUT5; fucosyltransferase 5 (alpha (1,3) fucosyltransferase); alpha-(1,3)-fucosyltransferase; FUC TV; fucT-V; fucosyltransferase V; alpha (1,3) fucosyltransferase; galactoside 3-L-fucosyltransferase; FUC-TV;
Gene ID 2527
mRNA Refseq NM_002034
Protein Refseq NP_002025
MIM 136835
UniProt ID Q11128

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All FUT5 Products

Required fields are marked with *

My Review for All FUT5 Products

Required fields are marked with *

0
cart-icon