Recombinant Human FUT5 Protein, GST-tagged
Cat.No. : | FUT5-4564H |
Product Overview : | Human FUT5 partial ORF ( NP_002025, 95 a.a. - 164 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | FUT5 (Fucosyltransferase 5) is a Protein Coding gene. Among its related pathways are Metabolism and Glycosphingolipid biosynthesis - lacto and neolacto series. GO annotations related to this gene include fucosyltransferase activity and 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity. An important paralog of this gene is FUT3. |
Molecular Mass : | 33.44 kDa |
AA Sequence : | SEMVPGAADCNITADSSVYPQADAVIVHHWDIMYNPSANLPPPTRPQGQRWIWFSMESPSNCRHLEALDG |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | FUT5 fucosyltransferase 5 (alpha (1,3) fucosyltransferase) [ Homo sapiens ] |
Official Symbol | FUT5 |
Synonyms | FUT5; fucosyltransferase 5 (alpha (1,3) fucosyltransferase); alpha-(1,3)-fucosyltransferase; FUC TV; fucT-V; fucosyltransferase V; alpha (1,3) fucosyltransferase; galactoside 3-L-fucosyltransferase; FUC-TV; |
Gene ID | 2527 |
mRNA Refseq | NM_002034 |
Protein Refseq | NP_002025 |
MIM | 136835 |
UniProt ID | Q11128 |
◆ Recombinant Proteins | ||
FUT5-3290P | Recombinant Pan troglodytes (Chimpanzee) FUT5, His-tagged | +Inquiry |
FUT5-1537H | Recombinant Human FUT5 Protein, His-tagged | +Inquiry |
FUT5-4564H | Recombinant Human FUT5 Protein, GST-tagged | +Inquiry |
FUT5-25H | Active Recombinant Human FUT5 Protein (AA 40-374), N-6×His/GFP tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FUT5 Products
Required fields are marked with *
My Review for All FUT5 Products
Required fields are marked with *
0
Inquiry Basket