Active Recombinant Human GCNT2 Protein (AA 26-400), N-6×His/GFP tagged
Cat.No. : | GCNT2-10H |
Product Overview : | Recombinant Human GCNT2 Protein (AA 26-400) with N-6×His/GFP tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | GFP&His |
Protein Length : | AA 26-400 |
Description : | This gene encodes the enzyme responsible for formation of the blood group I antigen. The i and I antigens are distinguished by linear and branched poly-N-acetyllactosaminoglycans, respectively. The encoded protein is the I-branching enzyme, a beta-1,6-N-acetylglucosaminyltransferase responsible for the conversion of fetal i antigen to adult I antigen in erythrocytes during embryonic development. Mutations in this gene have been associated with adult i blood group phenotype. Alternatively spliced transcript variants encoding different isoforms have been described. |
Bio-activity : | ≥ 0.02 μmol/min/mg |
Molecular Mass : | ~75 kDa |
AA Sequence : | NFGGDPSFQRLNISDPLRLTQVCTSFINGKTRFLWKNKLMIHEKSSCKEYLTQSHYITAPLSKEEADFPLAYIMVIHHHFDTFARLFRAIYMPQNIYCVHVDEKATTEFKDAVEQLLSCFPNAFLASKMEPVVYGGISRLQADLNCIRDLSAFEVSWKYVINTCGQDFPLKTNKEIVQYLKGFKGKNITPGVLPPAHAIGRTKYVHQEHLGKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFANFVLHDPRAVDLLQWSKDTFSPDEHFWVTLNRIPGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF |
Purity : | >95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain. |
Stability : | 6 months if stored at -80 centigrade. Avoid repeated freeze thaws. |
Concentration : | 1 mg/mL |
Storage Buffer : | Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol. |
Preservative : | 0.05 % NaN3 |
Shipping : | This product is shipped as 0.2μm filtered product on dry ice. |
Gene Name | GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) [ Homo sapiens (human) ] |
Official Symbol | GCNT2 |
Synonyms | GCNT2; glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group); cataract, congenital , CCAT, GCNT5, glucosaminyl (N acetyl) transferase 2, I branching enzyme , glucosaminyl (N acetyl) transferase 2, I branching enzyme (Ii blood group) , glucosaminyl (N acetyl) transferase 5 , II, NACGT1; N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase; bA360O19.2; bA421M1.1; IGNT; Ii blood group; NAGCT1; ULG3; unassigned linkage group 3; I beta-1,6-N-acetylglucosaminyltransferase; beta-1,6-N-acetylglucosaminyltransferase 2; II; CCAT; GCNT5; GCNT2C; NACGT1; MGC163396; |
Gene ID | 2651 |
mRNA Refseq | NM_001491 |
Protein Refseq | NP_001482 |
MIM | 600429 |
UniProt ID | Q06430 |
◆ Recombinant Proteins | ||
RFL3098MF | Recombinant Full Length Mouse N-Acetyllactosaminide Beta-1,6-N-Acetylglucosaminyl-Transferase(Gcnt2) Protein, His-Tagged | +Inquiry |
GCNT2-5186HF | Recombinant Full Length Human GCNT2 Protein, GST-tagged | +Inquiry |
GCNT2-89H | Recombinant Human GCNT2, His-tagged | +Inquiry |
GCNT2-667H | Recombinant Human GCNT2 Protein, MYC/DDK-tagged | +Inquiry |
GCNT2-4805H | Recombinant Human GCNT2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GCNT2-5979HCL | Recombinant Human GCNT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GCNT2 Products
Required fields are marked with *
My Review for All GCNT2 Products
Required fields are marked with *