Active Recombinant Human GCNT2 Protein (AA 26-400), N-6×His/GFP tagged
| Cat.No. : | GCNT2-10H |
| Product Overview : | Recombinant Human GCNT2 Protein (AA 26-400) with N-6×His/GFP tag was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | GFP&His |
| Protein Length : | AA 26-400 |
| Description : | This gene encodes the enzyme responsible for formation of the blood group I antigen. The i and I antigens are distinguished by linear and branched poly-N-acetyllactosaminoglycans, respectively. The encoded protein is the I-branching enzyme, a beta-1,6-N-acetylglucosaminyltransferase responsible for the conversion of fetal i antigen to adult I antigen in erythrocytes during embryonic development. Mutations in this gene have been associated with adult i blood group phenotype. Alternatively spliced transcript variants encoding different isoforms have been described. |
| Bio-activity : | ≥ 0.02 μmol/min/mg |
| Molecular Mass : | ~75 kDa |
| AA Sequence : | NFGGDPSFQRLNISDPLRLTQVCTSFINGKTRFLWKNKLMIHEKSSCKEYLTQSHYITAPLSKEEADFPLAYIMVIHHHFDTFARLFRAIYMPQNIYCVHVDEKATTEFKDAVEQLLSCFPNAFLASKMEPVVYGGISRLQADLNCIRDLSAFEVSWKYVINTCGQDFPLKTNKEIVQYLKGFKGKNITPGVLPPAHAIGRTKYVHQEHLGKELSYVIRTTALKPPPPHNLTIYFGSAYVALSREFANFVLHDPRAVDLLQWSKDTFSPDEHFWVTLNRIPGVPGSMPNASWTGNLRAIKWSDMEDRHGGCHGHYVHGICIYGNGDLKWLVNSPSLFANKFELNTYPLTVECLELRHRERTLNQSETAIQPSWYF |
| Purity : | >95%, by SDS-PAGE under reducing conditions and visualized by Coomassie Blue stain. |
| Stability : | 6 months if stored at -80 centigrade. Avoid repeated freeze thaws. |
| Concentration : | 1 mg/mL |
| Storage Buffer : | Supplied as a 0.2 μm filtered solution in 20mM HEPES pH 7.0 and 100mM NaCl buffer, with 10% Glycerol. |
| Preservative : | 0.05 % NaN3 |
| Shipping : | This product is shipped as 0.2μm filtered product on dry ice. |
| Gene Name | GCNT2 glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group) [ Homo sapiens (human) ] |
| Official Symbol | GCNT2 |
| Synonyms | GCNT2; glucosaminyl (N-acetyl) transferase 2, I-branching enzyme (I blood group); cataract, congenital , CCAT, GCNT5, glucosaminyl (N acetyl) transferase 2, I branching enzyme , glucosaminyl (N acetyl) transferase 2, I branching enzyme (Ii blood group) , glucosaminyl (N acetyl) transferase 5 , II, NACGT1; N-acetyllactosaminide beta-1,6-N-acetylglucosaminyl-transferase; bA360O19.2; bA421M1.1; IGNT; Ii blood group; NAGCT1; ULG3; unassigned linkage group 3; I beta-1,6-N-acetylglucosaminyltransferase; beta-1,6-N-acetylglucosaminyltransferase 2; II; CCAT; GCNT5; GCNT2C; NACGT1; MGC163396; |
| Gene ID | 2651 |
| mRNA Refseq | NM_001491 |
| Protein Refseq | NP_001482 |
| MIM | 600429 |
| UniProt ID | Q06430 |
| ◆ Cell & Tissue Lysates | ||
| GCNT2-5979HCL | Recombinant Human GCNT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GCNT2 Products
Required fields are marked with *
My Review for All GCNT2 Products
Required fields are marked with *



