Active Recombinant Human GDF5 Protein

Cat.No. : GDF5-107H
Product Overview : Recombinant Human GDF5 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Growth differentiation factor 5 (GDF-5) is a member of the bone morphogenetic protein (BMP) and transforming growth factor beta (TGF-β) families and functions to regulate cell proliferation and differentiation in embryonic and adult tissues. GDF-5 is expressed in the central nervous system and promotes the survival of dopaminergic neurons in animal models of Parkinson’s disease. GDF-5 is also important during chondrogenesis and chondrocyte differentiation.
Bio-activity : Alkaline phosphatase activity in ATDC5 cells, ≤1.2 μg/mL
Molecular Mass : Dimer, 13.7/27.4 kDa (121/242 aa)
AA Sequence : MAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name GDF5 growth differentiation factor 5 [ Homo sapiens (human) ]
Official Symbol GDF5
Synonyms GDF5; growth differentiation factor 5; growth/differentiation factor 5; BMP14; cartilage derived morphogenetic protein 1; CDMP1; GDF-5; CDMP-1; radotermin; cartilage-derived morphogenetic protein-1; OS5; LAP4; SYNS2;
Gene ID 8200
mRNA Refseq NM_000557
Protein Refseq NP_000548
MIM 601146
UniProt ID P43026

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All GDF5 Products

Required fields are marked with *

My Review for All GDF5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon