Active Recombinant Human GDF5 Protein
Cat.No. : | GDF5-107H |
Product Overview : | Recombinant Human GDF5 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Growth differentiation factor 5 (GDF-5) is a member of the bone morphogenetic protein (BMP) and transforming growth factor beta (TGF-β) families and functions to regulate cell proliferation and differentiation in embryonic and adult tissues. GDF-5 is expressed in the central nervous system and promotes the survival of dopaminergic neurons in animal models of Parkinson’s disease. GDF-5 is also important during chondrogenesis and chondrocyte differentiation. |
Bio-activity : | Alkaline phosphatase activity in ATDC5 cells, ≤1.2 μg/mL |
Molecular Mass : | Dimer, 13.7/27.4 kDa (121/242 aa) |
AA Sequence : | MAPLATRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | GDF5 growth differentiation factor 5 [ Homo sapiens (human) ] |
Official Symbol | GDF5 |
Synonyms | GDF5; growth differentiation factor 5; growth/differentiation factor 5; BMP14; cartilage derived morphogenetic protein 1; CDMP1; GDF-5; CDMP-1; radotermin; cartilage-derived morphogenetic protein-1; OS5; LAP4; SYNS2; |
Gene ID | 8200 |
mRNA Refseq | NM_000557 |
Protein Refseq | NP_000548 |
MIM | 601146 |
UniProt ID | P43026 |
◆ Recombinant Proteins | ||
Gdf5-720M | Active Recombinant Mouse Growth Differentiation Factor 5 | +Inquiry |
Gdf5-651M | Recombinant Mouse Gdf5 protein | +Inquiry |
GDF5-3521M | Recombinant Mouse GDF5 Protein, His (Fc)-Avi-tagged | +Inquiry |
GDF5-2449H | Recombinant Human GDF5 Protein (Ala382-Arg501), His tagged | +Inquiry |
Gdf5-7211M | Recombinant Mouse Gdf5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDF5-5968HCL | Recombinant Human GDF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GDF5 Products
Required fields are marked with *
My Review for All GDF5 Products
Required fields are marked with *