Recombinant Mouse Gdf5 Protein, His-tagged

• Cat.No.: Gdf5-7211M
• Product Overview: Recombinant mouse GDF5 protein, fused to His-tag at N-terminus, was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: His
• Protein Length: 376-495
• Description: This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates the development of numerous tissue and cell types, including cartilage, joints, brown fat, teeth, and the growth of neuronal axons and dendrites. Mice with a mutation in this gene exhibit enhanced tooth enamel formation.
• Form: Liquid
• Molecular Mass: 16 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMGSAPLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
• Purity: > 90 % by SDS-PAGE
• Stability: Shelf life: one year from despatch.
• Storage: Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
• Concentration: 0.5 mg/mL (determined by Bradford assay)
• Storage Buffer: 20 mM Tris-HCl buffer (pH 8.0) containing 10 % glycerol.

Gene Information

• Gene Name: Gdf5 growth differentiation factor 5 [ Mus musculus (house mouse) ]
• Official Symbol: Gdf5
• Synonyms: Gdf5; growth differentiation factor 5; b; bp; brp; CDMP-; BMP-14; Cdmp-1; growth/differentiation factor 5; bone morphogenetic protein 14; cartilage-derived morphogenetic protein-1
• Gene ID: 14563
• mRNA Refseq: NM_008109
• Protein Refseq: NP_032135
• UniProt ID: P43027