Recombinant Mouse Gdf5 Protein, His-tagged

Cat.No. : Gdf5-7211M
Product Overview : Recombinant mouse GDF5 protein, fused to His-tag at N-terminus, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 376-495
Description : This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates the development of numerous tissue and cell types, including cartilage, joints, brown fat, teeth, and the growth of neuronal axons and dendrites. Mice with a mutation in this gene exhibit enhanced tooth enamel formation.
Form : Liquid
Molecular Mass : 16 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMGSAPLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR
Purity : > 90 % by SDS-PAGE
Stability : Shelf life: one year from despatch.
Storage : Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing.
Concentration : 0.5 mg/mL (determined by Bradford assay)
Storage Buffer : 20 mM Tris-HCl buffer (pH 8.0) containing 10 % glycerol.
Gene Name Gdf5 growth differentiation factor 5 [ Mus musculus (house mouse) ]
Official Symbol Gdf5
Synonyms Gdf5; growth differentiation factor 5; b; bp; brp; CDMP-; BMP-14; Cdmp-1; growth/differentiation factor 5; bone morphogenetic protein 14; cartilage-derived morphogenetic protein-1
Gene ID 14563
mRNA Refseq NM_008109
Protein Refseq NP_032135
UniProt ID P43027

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Gdf5 Products

Required fields are marked with *

My Review for All Gdf5 Products

Required fields are marked with *

0
cart-icon