Recombinant Mouse Gdf5 Protein, His-tagged
Cat.No. : | Gdf5-7211M |
Product Overview : | Recombinant mouse GDF5 protein, fused to His-tag at N-terminus, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Protein Length : | 376-495 |
Description : | This gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates the development of numerous tissue and cell types, including cartilage, joints, brown fat, teeth, and the growth of neuronal axons and dendrites. Mice with a mutation in this gene exhibit enhanced tooth enamel formation. |
Form : | Liquid |
Molecular Mass : | 16 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMGSAPLANRQGKRPSKNLKARCSRKALHVNFKDMGWDDWIIAPLEYEAFHCEGLCEFPLRSHLEPTNHAVIQTLMNSMDPESTPPTCCVPTRLSPISILFIDSANNVVYKQYEDMVVESCGCR |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for one week or (in aliquots) at -20 to -80 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 10 % glycerol. |
Gene Name | Gdf5 growth differentiation factor 5 [ Mus musculus (house mouse) ] |
Official Symbol | Gdf5 |
Synonyms | Gdf5; growth differentiation factor 5; b; bp; brp; CDMP-; BMP-14; Cdmp-1; growth/differentiation factor 5; bone morphogenetic protein 14; cartilage-derived morphogenetic protein-1 |
Gene ID | 14563 |
mRNA Refseq | NM_008109 |
Protein Refseq | NP_032135 |
UniProt ID | P43027 |
◆ Recombinant Proteins | ||
GDF-5300H | Recombinant Human Growth Differentiation Factor 5, His-tagged | +Inquiry |
GDF5-3521M | Recombinant Mouse GDF5 Protein, His (Fc)-Avi-tagged | +Inquiry |
GDF5-4827H | Recombinant Human GDF5 Protein, GST-tagged | +Inquiry |
GDF5-107H | Active Recombinant Human GDF5 Protein | +Inquiry |
Gdf5-7211M | Recombinant Mouse Gdf5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GDF5-5968HCL | Recombinant Human GDF5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Gdf5 Products
Required fields are marked with *
My Review for All Gdf5 Products
Required fields are marked with *
0
Inquiry Basket