Active Recombinant Human GZMA protein, His-tagged

• Cat.No.: GZMA-574H
• Product Overview: Active Recombinant Human GZMA protein(NP_006135.1)(29-262 aa) is expressed from HEK293 with His tag at the C-Terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Form: Lyophilized from sterile PBS, pH7.4, 5% trehalose, 5% Mannitol.
• Bio-activity: Measured by its ability to cleave a colorimetric peptide substrate, N-carbobenzyloxy-Gly-Arg-ThioBenzyl ester (Z-GR-SBzl), in the presence of 5,5’Dithio-bis (2-nitrobenzoic acid) (DTNB). The specific activity is 12019 pmol/min/µg, as measured under the described conditions.
• Molecular Mass: The recombinant human GZMA consists of 245 amino acids and predicts a molecular mass of 27.29 kDa.
• AASequence: IIGGNEVTPHSRPYMVLLSLDRKTICAGALIAKDWVLTAAHCNLNKRSQVILGAHSITREEPTKQIMLVKKEFPYPCYDPATREGDLKLLQLMEKAKINKYVTILHLPKKGDDVKPGTMCQVAGWGRTHNSASWSDTLREVNITIIDRKVCNDRNHYNFNPVIGMNMVCAGSLRGGRDSCNGDSGSPLLCEGVFRGVTSFGLENKCGDPRGPGVYILLSKKHLNWIIMTIKGAVAHHHHHHHHHH
• Endotoxin: <1.0EU per 1µg (determined by the LAL method).
• Purity: > 95% as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.27mg/ml. Centrifuge the vial at 4°C before opening to recover the entire contents.

Gene Information

• Gene Name: GZMA granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3) [ Homo sapiens ]
• Official Symbol: GZMA
• Synonyms: GZMA; granzyme A (granzyme 1, cytotoxic T-lymphocyte-associated serine esterase 3); CTLA3, HFSP; granzyme A; CTL tryptase; Granzyme A (Cytotoxic T lymphocyte associated serine esterase 3; Hanukah factor serine protease); HF; h factor; fragmentin-1; cytotoxic T-lymphocyte proteinase 1; Granzyme A (Cytotoxic T-lymphocyte-associated serine esterase-3; Hanukah factor serine protease); HFSP; CTLA3
• Gene ID: 3001
• mRNA Refseq: NM_006144
• Protein Refseq: NP_006135
• MIM: 140050
• UniProt ID: P12544