Active Recombinant Human HAVCR2, Fc-tagged, Biotinylated
Cat.No. : | HAVCR2-704H |
Product Overview : | The recombinant human TIM-3-Fc fusion protein is expressed as a 409 amino acid protein consisting of Ser22 - Gly202 region of TIM-3 (UniProt accession #Q8TDQ0) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Fc |
Protein Length : | 22-202 a.a. |
Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier & preservative free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
Bio-activity : | Binds its ligand Galectin-9 and blocks Galectin-9/TIM-3 mediated signaling activity. |
Molecular Mass : | Calculated molecular mass (kDa): 45.6; Estimated by SDS-PAGE under reducing condition (kDa): ~65 (probably due to glycosylation). |
AA Sequence : | SEVEYRAEVGQNAYLPCFYTPAAPGNLVPVCWGKGACPVFECGNVVLRTDERDVNYWTSRYWLNGDFRKGDVSLT IENVTLADSGIYCCRIQIPGIMNDEKFNLKLVIKPAKVTPAPTRQRDFTAAFPRMLTTRGHGPAETQTLGSLPD INLTQISTLANELRDSRLANDLRDSGATIRIGSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTC VVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKT ISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK |
Endotoxin : | <0.1 eu="" per="" 1="" μg="" of="" purified="" recombinant="" protein="" determined="" by="" the="" lal="">0.1> |
Purity : | >95% judged by SDS-PAGE under reducing condition |
Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
Gene Name | HAVCR2 hepatitis A virus cellular receptor 2 [ Homo sapiens ] |
Official Symbol | HAVCR2 |
Synonyms | HAVCR2; hepatitis A virus cellular receptor 2; FLJ14428; Tim 3; TIM3; TIMD3; kidney injury molecule-3; T-cell membrane protein 3; T cell immunoglobulin mucin 3; T cell immunoglobulin mucin-3; T-cell immunoglobulin and mucin domain-containing protein 3; KIM-3; Tim-3; TIMD-3; HAVcr-2; |
Gene ID | 84868 |
mRNA Refseq | NM_032782 |
Protein Refseq | NP_116171 |
MIM | 606652 |
UniProt ID | Q8TDQ0 |
Chromosome Location | 5q34 |
◆ Recombinant Proteins | ||
HAVCR2-529MAF647 | Recombinant Mouse Havcr2 Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
HAVCR2-513H | Recombinant Human HAVCR2, Fc-tagged | +Inquiry |
HAVCR2-3166HAF488 | Recombinant Human HAVCR2 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
Havcr2-5715M | Recombinant Mouse Havcr2 Protein (Leu22-Ala193), C-His tagged | +Inquiry |
HAVCR2-439H | Recombinant Human HAVCR2 Protein, DDK/His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAVCR2-001CCL | Recombinant Cynomolgus HAVCR2 cell lysate | +Inquiry |
HAVCR2-995MCL | Recombinant Mouse HAVCR2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAVCR2 Products
Required fields are marked with *
My Review for All HAVCR2 Products
Required fields are marked with *