Active Recombinant Human HBEGF Protein

Cat.No. : HBEGF-269H
Product Overview : Recombinant Human HBEGF Protein without tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Description : Proheparin-binding EGF-like growth factor (HB-EGF), also known as DTR, DTS and HEGFL, is a member of the EGF family of mitogens. It is expressed in macrophages, monocytes, endothelial cells and muscle cells. HB-EGF signals through the EGF receptor to stimulate the proliferation of smooth muscle cells, epithelial cells and keratinocytes. Compared to EGF, HB-EGF binds the EGF receptor with higher affinity and is thus more mitogenic, probably due to its ability to bind to heparin and heparin sulfate proteoglycans. HB-EGF has been reported to act as a diphtheria toxin receptor, mediating endocytosis of the bound toxin.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.5 ng/mL, measured in a cell proliferation assay using 3T3 cells.
Molecular Mass : 12-14 kDa, observed by reducing SDS-PAGE.
AA Sequence : DLQEADLDLLRVTLSSKPQALATPNKEEHGKRKKKGKGLGKKRDPCLRKYKDFCIHGECKYVKELRAPSCICHPGYHGERCHGLSL
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant Human HB-EGF remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human HB-EGF should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name HBEGF heparin-binding EGF-like growth factor [ Homo sapiens ]
Official Symbol HBEGF
Synonyms HBEGF; heparin-binding EGF-like growth factor; diphtheria toxin receptor (heparin binding epidermal growth factor like growth factor), DTR, DTS, HEGFL; proheparin-binding EGF-like growth factor; Diphtheria toxin receptor (heparin binding EGF like growth factor); heparin binding epidermal growth factor; heparin-binding epidermal growth factor; diphtheria toxin receptor (heparin-binding EGF-like growth factor); diphtheria toxin receptor (heparin-binding epidermal growth factor-like growth factor); DTR; DTS; DTSF; HEGFL;
Gene ID 1839
mRNA Refseq NM_001945
Protein Refseq NP_001936
MIM 126150
UniProt ID Q99075

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HBEGF Products

Required fields are marked with *

My Review for All HBEGF Products

Required fields are marked with *

0
cart-icon