Active Recombinant Human ICOSLG, Fc-tagged, Biotinylated
| Cat.No. : | ICOSLG-541H |
| Product Overview : | The recombinant human B7-H2/ICOSL/CD275-Fc fusion protein is expressed as a 466 amino acid protein consisting of Asp19 - Thr256 region of B7-H2 (UniProt accession #O75144) and a C-terminal Fc fusion from human IgG1, which exists as a dimer under non-reducing condition. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Human Cells |
| Tag : | Fc |
| Protein Length : | 19-256 a.a. |
| Form : | Supplied at 0.5 mg/ml in sterile PBS pH7.4 (carrier free). The purified recombinant protein was labeled with Biotin (3-5 Biotin per molecule). |
| Bio-activity : | Binds human ICOS and stimulates human T cell proliferation in the presence of anti-CD3. |
| Molecular Mass : | Calculated molecular mass 52 kDa; estimated by SDS-PAGE under reducing condition ~75 kDa probably due to glycosylation. |
| AA Sequence : | DTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESKTVVTYHIPQNSSLENVDSRYRNRALMSPAGMLR GDFSLRLFNVTPQDEQKFHCLVLSQSLGFQEVLSVEVTLHVAANFSVPVVSAPHSPSQDELTFTCTSINGYPRP NVYWINKTDNSLLDQALQNDTVFLNMRGLYDVVSVLRIARTPSVNIGCCIENVLLQQNLTVGSQTGNDIGERDK ITENPVSTGEKNAATSTGTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWY VDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLP PSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCS VMHEALHNHYTQKSLSLSPGK |
| Endotoxin : | <0.1 eu per 1 μg of purified recombinant protein determined by the |
| Purity : | >95% judged by SDS-PAGE under reducing condition |
| Storage : | The product is shipped at 4°C. Upon receipt, centrifuge the product briefly before opening the vial. It is recommended to store small aliquots at the temperature below –20°C for long-term storage and the product is stable for 3 months. The undiluted protein can be stored at 4°C for no more than 2 weeks. Avoid repeated freeze-thaw cycles. |
| Conjugation : | Biotin |
| Gene Name | ICOSLG inducible T-cell co-stimulator ligand [ Homo sapiens ] |
| Official Symbol | ICOSLG |
| Synonyms | ICOSLG; inducible T-cell co-stimulator ligand; ICOSL; ICOS ligand; B7 homolog 2; B7 homologue 2; B7 H2; B7 related protein 1; B7H2; B7RP 1; B7RP1; CD275; GL50; ICOS L; KIAA0653; B7-like protein Gl50; B7-related protein 1; transmembrane protein B7-H2 ICOS ligand; B7-H2; LICOS; B7RP-1; ICOS-L; |
| Gene ID | 23308 |
| mRNA Refseq | NM_015259 |
| Protein Refseq | NP_056074 |
| MIM | 605717 |
| UniProt ID | O75144 |
| Chromosome Location | 21q22.3 |
| Pathway | Adaptive Immune System, organism-specific biosystem; Cell adhesion molecules (CAMs), organism-specific biosystem; Cell adhesion molecules (CAMs), conserved biosystem; Costimulation by the CD28 family, organism-specific biosystem; Immune System, organism-specific biosystem; Intestinal immune network for IgA production, organism-specific biosystem; Intestinal immune network for IgA production, conserved biosystem; |
| Function | receptor binding; |
| ◆ Recombinant Proteins | ||
| ICOSLG-533H | Recombinant Human ICOSLG Protein (Asp19-Thr256), C-mFc and 6×His-tagged | +Inquiry |
| ICOSLG-2143H | Recombinant Human Inducible T-cell Co-stimulator Ligand, Fc Chimera | +Inquiry |
| ICOSLG-425HAF647 | Recombinant Human ICOSLG Protein, hFc-tagged, Alexa Fluor 647 conjugated | +Inquiry |
| ICOSLG-6641C | Recombinant Chicken ICOSLG | +Inquiry |
| ICOSLG-3213HAF555 | Recombinant Human ICOSLG Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ICOSLG-1095HCL | Recombinant Human ICOSLG cell lysate | +Inquiry |
| ICOSLG-2618MCL | Recombinant Mouse ICOSLG Overexpression Lysate(Met 1-Lys 279) | +Inquiry |
| ICOSLG-2804MCL | Recombinant Mouse ICOSLG Overexpression Lysate(Met 1-Lys 279) | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ICOSLG Products
Required fields are marked with *
My Review for All ICOSLG Products
Required fields are marked with *
