Active Recombinant Human IFNB1 Protein

• Cat.No.: IFNB1-186I
• Product Overview: Recombinant Human IFNB1 Protein without tag was expressed in HEK 293.

Specification

• Species: Human
• Source: HEK293
• Description: Interferon-beta (IFN-β), acting via STAT1 and STAT2, is known to upregulate and downregulate a wide variety of genes, most of which are involved in the antiviral immune response. It is a member of Type I IFNs, which include IFN-α, -β, τ, and –ω. IFN-β plays an important role in inducing non-specific resistance against a broad range of viral infections. It also affects cell proliferation and modulates immune responses.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 0.1 ng/mL, measured in a proliferation assay using TF-1 Cells.
• Molecular Mass: ~23 kDa, observed by reducing SDS-PAGE.
• AA Sequence: MSYNLLGFLQRSSNFQCQKLLWQLNGRLEYCLKDRMNFDIPEEIKQLQQFQKEDAALTIYEMLQNIFAIFRQDSSSTGWNETIVENLLANVYHQINHLKTVLEEKLEKEDFTRGKLMSSLHLKRYYGRILHYLKAKEYSHCAWTIVRVEILRNFYFINRLTGYLRN
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE.
• Storage: Lyophilized recombinant Human Interferon-beta remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, Human Interferon-beta should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O or PBS at 100 μg/mL.

Gene Information

• Gene Name: IFNB1 interferon, beta 1, fibroblast [ Homo sapiens ]
• Official Symbol: IFNB1
• Synonyms: IFNB1; interferon, beta 1, fibroblast; IFNB; interferon beta; IFB; IFF; IFN-beta; fibroblast interferon; MGC96956
• Gene ID: 3456
• mRNA Refseq: NM_002176
• Protein Refseq: NP_002167
• MIM: 147640
• UniProt ID: P01574