Active Recombinant Human IL15 Protein, His-tagged

Cat.No. : IL15-004H
Product Overview : Recombinant human IL-15 protein (49-162 aa), fused to His-tag was expressed in E.coli and purified by using conventional chromatography after refolding of the isolated inclusion bodies in a redox buffer
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 49-162 a.a.
Description : Interleukin (IL)-15 is a pleiotropic cytokine that plays a pivotal role in both innate and adaptive immunity. IL-15 is unique among cytokines due to its participation in a trans signaling mechanism in which IL-15 receptor alpha (IL-15R alpha) from one subset of cells presents IL-15 to neighboring IL-2R beta/gamma(c)-expressing cells. This newly discovered cytokine is produced by a wide variety of cells and tissues and like IL-2, stimulates the proliferation of T-lymphocytes and induces the generation of cytotoxic T-lymphocytes (CTLs) and lymphokine-activated killer (LAK) cells.
Form : Liquid
Bio-activity : Measured in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells. The ED50 for this effect is less or equal to 1 ng/mL.
Molecular Mass : 13.9 kDa (123aa) confirmed by MALDI-TOF
AA Sequence : MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTSLEHHHHHH
Endotoxin : < 1.0 EU per 1μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Notes : For research use only. This product is not intended or approved for human, diagnostics or veterin.
Storage : Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 or -70 centigrade.
Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by Bradford assay)
Storage Buffer : In Phosphate Buffer Saline(pH7.4) containing 10% glycerol.
Gene Name IL15 interleukin 15 [ Homo sapiens (human) ]
Official Symbol IL15
Synonyms Interleukin-15; IL-15; interleukin-15
Gene ID 3600
mRNA Refseq NM_172175
Protein Refseq NP_751914
MIM 600554
UniProt ID P40933

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL15 Products

Required fields are marked with *

My Review for All IL15 Products

Required fields are marked with *

0
cart-icon