| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
49-162 a.a. |
| Description : |
Interleukin (IL)-15 is a pleiotropic cytokine that plays a pivotal role in both innate and adaptive immunity. IL-15 is unique among cytokines due to its participation in a trans signaling mechanism in which IL-15 receptor alpha (IL-15R alpha) from one subset of cells presents IL-15 to neighboring IL-2R beta/gamma(c)-expressing cells. This newly discovered cytokine is produced by a wide variety of cells and tissues and like IL-2, stimulates the proliferation of T-lymphocytes and induces the generation of cytotoxic T-lymphocytes (CTLs) and lymphokine-activated killer (LAK) cells. |
| Form : |
Liquid |
| Bio-activity : |
Measured in a cell proliferation assay using CTLL-2 mouse cytotoxic T cells. The ED50 for this effect is less or equal to 1 ng/mL. |
| Molecular Mass : |
13.9 kDa (123aa) confirmed by MALDI-TOF |
| AA Sequence : |
MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTSLEHHHHHH |
| Endotoxin : |
< 1.0 EU per 1μg of protein (determined by LAL method) |
| Purity : |
> 95% by SDS-PAGE |
| Notes : |
For research use only. This product is not intended or approved for human, diagnostics or veterin. |
| Storage : |
Can be stored at +4 centigrade short term (1-2 weeks). For long term storage, aliquot and store at -20 or -70 centigrade.
Avoid repeated freezing and thawing cycles. |
| Concentration : |
1 mg/mL (determined by Bradford assay) |
| Storage Buffer : |
In Phosphate Buffer Saline(pH7.4) containing 10% glycerol. |
