Active Recombinant Human IL23 / IL23A & IL12B Heterodimer Protein, Tag free, Low Endotoxin

Cat.No. : IL23A&IL12B-333H
Product Overview : Active Recombinant Human IL23 /IL23A & IL12B Heterodimer Protein(P29460(P40), AAG37232(P19))(P40(Ile23-Ser328) and P19 (Arg23-Pro189)) was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : CHO
Tag : Non
Protein Length : 23-328 aa & 23-189 aa
Form : Lyophilized from a 0.22 μm-filtered solution containing PBS, 5% mannitol and 0.01% Tween 80, pH 7.4
Bio-activity : Measured by its ability to induce Interferon gamma secretion by human natural killer lymphoma NK-92 cells. The ED50 for this effect is <0.5 μg/mL.
Molecular Mass : 75.2 kDa
AASequence : VPDKTVRWCAVSEHEATKCQSFRDHMKSVIPSDGPSVACVKKASYLDCIRAIAANEADAVTLDAGLVYDAYLAPNNLKPVVAEFYGSKEDPQTFYYAVAVVKKDSGFQMNQLRGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVANFFSGSCAPCADGTDFPQLCQLCPGCGCSTLNQYFGYSGAFKCLKDGAGDVAFVKHSTIFENLANKADRDQYELLCLDNTRKPVDEYKDCHLAQVPSHTVVARSMG/VAIL GKEDLIWELLNQAQEHFGKDKSKEFQLFSSPHGKDLLFKDSAHGFLKVPPRMDAKMYLGYEYVTAIRNLREGTCPEAPTDECKPVKWCALSHHERLKCDEWSVNSVGKIECVSAETTEDCIAKIMNGEADAMSLDGGFVYIAGKCGLVPVLAENYNKSDNCEDTPEAGYFAIAVVKKSASDLTWDNLKGKKSCHTAVGRTAGWNIPMG/VAIL LLYNKINHCRFDEFFSEGCAPGSKKDSSLCKLCMG/VAIL SGLNLCEPNNKEGYYGYTGAFRCLVEKGDVAFVKHQTVPQNTGGKNPDPWAKNLNEKDYELLCLDGTRKPVEEYANCHLARAPNHAVVTRKDKEACVHKILRQQQHLFGSNVTDCSGNFCLFRSETKDLLFRDDTVCLAKLHDRNTYEKYLGEEYVKAVGNLRKCSTSSLLEACTFRRP
Endotoxin : ≤10 EU/mg by the LAL method
Purity : ≥95%, by SDS-PAGE (under reducing (R) & Non-reducing conditions, visualized by Coomassie staining)
Storage : 36 months at 2°C to 8°C in lyophilized state 6 months at -20°C to -80°C under sterile conditions after reconstitution 7-10 days at 2°C to 8°C under sterile conditions after reconstitution Use a manual defrost freezer and avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended to redissolve in sterile deionized water.
Gene Name IL23A interleukin 23, alpha subunit p19 [ Homo sapiens ]
Official Symbol IL23A
Synonyms IL23A; interleukin 23, alpha subunit p19; interleukin-23 subunit alpha; IL 23; IL 23A; IL23P19; interleukin six; G CSF related factor; P19; SGRF; IL-23-A; IL-23p19; IL-23 subunit alpha; interleukin 23 p19 subunit; interleukin-23 subunit p19; JKA3 induced upon T-cell activation; interleukin-six, G-CSF related factor; IL-23; IL-23A; MGC79388;
Gene ID 51561
mRNA Refseq NM_016584
Protein Refseq NP_057668
MIM 605580
UniProt ID Q9NPF7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL23A; IL12B Products

Required fields are marked with *

My Review for All IL23A; IL12B Products

Required fields are marked with *

0
cart-icon
0
compare icon