Active Recombinant Human IL23A Protein

Cat.No. : IL23A-966H
Product Overview : Recombinant Human IL23A was expressed in Hi-5 insect cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Hi-5 Insect Cells
Tag : Non
Description : This gene encodes a subunit of the heterodimeric cytokine interleukin 23 (IL23). IL23 is composed of this protein and the p40 subunit of interleukin 12 (IL12B). The receptor of IL23 is formed by the beta 1 subunit of IL12 (IL12RB1) and an IL23 specific subunit, IL23R. Both IL23 and IL12 can activate the transcription activator STAT4, and stimulate the production of interferon-gamma (IFNG). In contrast to IL12, which acts mainly on naive CD4(+) T cells, IL23 preferentially acts on memory CD4(+) T cells.
Form : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer, 100mM NaCl, pH 7.2
Bio-activity : Measured by its ability to induce IL-17 secretion by mouse splenocytes.
Molecular Mass : 53.5 kDa
AA Sequence : RAVPGGSSPAWTQCQQLSQKLCTLAWSAHPLVGHMDLREEGDEETTNDVPHIQCGDGCDPQGLRDNSQFCLQRIHQGLIFYEKLLGSDIFTGEPSLLPDSPVGQLHASLLGLSQLLQPEGHHWETQQIPSLSPSQPWQRLLLRFKILRSLQAFVAVAARVFAHGAATLSPIWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCS
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Concentration : Resuspend the protein in the desired concentration in proper buffer
Gene Name IL23A interleukin 23, alpha subunit p19 [ Homo sapiens ]
Official Symbol IL23A
Synonyms IL23A; interleukin 23, alpha subunit p19; interleukin-23 subunit alpha; IL 23; IL 23A; IL23P19; interleukin six; G CSF related factor; P19; SGRF; IL-23-A; IL-23p19; IL-23 subunit alpha; interleukin 23 p19 subunit; interleukin-23 subunit p19; JKA3 induced upon T-cell activation; interleukin-six, G-CSF related factor; IL-23; IL-23A; MGC79388;
Gene ID 51561
mRNA Refseq NM_016584
Protein Refseq NP_057668
MIM 605580
UniProt ID Q9NPF7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (1)

Customer Reviews

Write a review

Q&As

Ask a question

Is this bioactive cyno IL-23 heterodimer (p19/p40) or just the cyno IL-23p19 subunit? 02/01/2023

Please inquiry our product manager with specific product.

Ask a Question for All IL23A Products

Required fields are marked with *

My Review for All IL23A Products

Required fields are marked with *

0
cart-icon