Active Recombinant Human IL29 Protein

• Cat.No.: IL29-5200H
• Product Overview: Human IL29 (Q8IU54 , 24 a.a. - 200 a.a.) partial recombinant protein expressed in Escherichia coli.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 24-200 a.a.
• Description: This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 28B (IL28B) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). [provided by RefSeq
• Form: Lyophilized
• Bio-activity: The ED50 is determined in an anti-viral assay using human HepG2 cells infected with EMCV is typically 1-5 ng/mL.
• Molecular Mass: 20 kDa
• AA Sequence: TSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST
• Endotoxin: < 0.1 ng/μg (1 EU/μg)
• Purity: > 90% by SDS-PAGE and HPLC
• Applications: Functional Study
  SDS-PAGE
• Storage: Store at -20 centigrade on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4 centigrade for 1 month or store at -20 centigrade for 6 months. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: Lyophilized from 20 mM PB, 130 mM NaCl, pH 7.5

Gene Information

• Gene Name: IL29 interleukin 29 (interferon, lambda 1) [ Homo sapiens ]
• Official Symbol: IL29
• Synonyms: IL29; interleukin 29 (interferon, lambda 1); interleukin 29; interleukin-29; IFNL1; IL 29; IFN-lambda-1; cytokine Zcyto21; interferon lambda-1; interferon-lambda-1; interferon, lambda 1; IL-29
• Gene ID: 282618
• mRNA Refseq: NM_172140
• Protein Refseq: NP_742152
• MIM: 607403
• UniProt ID: Q8IU54