Active Recombinant Human IL29 Protein
Cat.No. : | IL29-5200H |
Product Overview : | Human IL29 (Q8IU54 , 24 a.a. - 200 a.a.) partial recombinant protein expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 24-200 a.a. |
Description : | This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 28B (IL28B) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). [provided by RefSeq |
Form : | Lyophilized |
Bio-activity : | The ED50 is determined in an anti-viral assay using human HepG2 cells infected with EMCV is typically 1-5 ng/mL. |
Molecular Mass : | 20 kDa |
AA Sequence : | TSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST |
Endotoxin : | < 0.1 ng/μg (1 EU/μg) |
Purity : | > 90% by SDS-PAGE and HPLC |
Applications : | Functional Study SDS-PAGE |
Storage : | Store at -20 centigrade on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4 centigrade for 1 month or store at -20 centigrade for 6 months. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | Lyophilized from 20 mM PB, 130 mM NaCl, pH 7.5 |
Gene Name | IL29 interleukin 29 (interferon, lambda 1) [ Homo sapiens ] |
Official Symbol | IL29 |
Synonyms | IL29; interleukin 29 (interferon, lambda 1); interleukin 29; interleukin-29; IFNL1; IL 29; IFN-lambda-1; cytokine Zcyto21; interferon lambda-1; interferon-lambda-1; interferon, lambda 1; IL-29; |
Gene ID | 282618 |
mRNA Refseq | NM_172140 |
Protein Refseq | NP_742152 |
MIM | 607403 |
UniProt ID | Q8IU54 |
◆ Recombinant Proteins | ||
IL29-381H | Recombinant Human IL29 protein(Met1-Thr200), His-tagged | +Inquiry |
IL29-1034P | Recombinant Pig IL29 Protein, His-tagged | +Inquiry |
IL29-002H | Active Recombinant Human IL29, HIgG1 Fc-tagged, mutant | +Inquiry |
IL29-100H | Recombinant Human IL29 protein | +Inquiry |
IL29-14194H | Recombinant Human IL29, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL29-5228HCL | Recombinant Human IL29 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL29 Products
Required fields are marked with *
My Review for All IL29 Products
Required fields are marked with *
0
Inquiry Basket