Active Recombinant Human IL6 Protein (30-212aa), N-His-tagged

Cat.No. : IL6-02H
Product Overview : Recombinant interleukin-6 (30-212aa) with N-His tag was expressed in E. coli and purifed by conventional chromatography, after refolding of the isolated inclusion bodies in a renaturation buffer.
Availability July 30, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 30-212aa
Description : This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. Elevated levels of the encoded protein have been found in virus infections, including COVID-19 (disease caused by SARS-CoV-2).
Form : Liquid
Bio-activity : Measured in a cell proliferation assay using TF-1 human erythroleukemic cell. The ED50 range ≤ 0.8 ng/mL.
Molecular Mass : 23.1 kDa (204aa) confirmed by MALDI-TOF
AA Sequence : VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by Bradford assay)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name IL6 interleukin 6 [ Homo sapiens (human) ]
Official Symbol IL6
Synonyms IL6; interleukin 6; CDF; HGF; HSF; BSF2; IL-6; BSF-2; IFNB2; IFN-beta-2; interleukin-6; B-cell differentiation factor; B-cell stimulatory factor 2; CTL differentiation factor; hybridoma growth factor; interferon beta-2; interleukin BSF-2
Gene ID 3569
mRNA Refseq NM_000600
Protein Refseq NP_000591
MIM 147620
UniProt ID P05231

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL6 Products

Required fields are marked with *

My Review for All IL6 Products

Required fields are marked with *

0
cart-icon