Active Recombinant Human IL6 Protein

Cat.No. : IL6-184H
Product Overview : Recombinant Human IL6 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : Interleukin 6 (IL-6) is an important pro-inflammatory and anti-inflammatory cytokine expressed by T cells, macrophages and muscle cells. IL-6 signals through a receptor complex containing two receptors, IL-6Rα and gp130. IL-6 has an important function in promoting fever and can serve to stimulate an immune response to trauma. IL-6 is often used for growth of hybridoma cell lines. Human IL-6 is active on mouse and rat cells.
Bio-activity : B9 cell proliferation, ≤25 pg/mL; ≥4.0 x 10^7 units/mg
Molecular Mass : Monomer, 21 kDa (185 aa)
AA Sequence : MPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name IL6 interleukin 6 (interferon, beta 2) [ Homo sapiens (human) ]
Official Symbol IL6
Synonyms IL6; interleukin 6 (interferon, beta 2); IFNB2; interleukin-6; BSF2; HGF; HSF; IL 6; CDF; BSF-2; IFN-beta-2; interferon beta-2; interleukin BSF-2; hybridoma growth factor; CTL differentiation factor; B-cell stimulatory factor 2; B-cell differentiation factor; IL-6;
Gene ID 3569
mRNA Refseq NM_000600
Protein Refseq NP_000591
MIM 147620
UniProt ID P05231

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL6 Products

Required fields are marked with *

My Review for All IL6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon