Active Recombinant Human IL6, His-tagged
| Cat.No. : | IL6-105H |
| Product Overview : | Recombinant Human Interleukin-6/IL-6 is produced by E. coli transformed with a plasmid contains sequence (Pro29-Met212) of Human IL-6 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 29-212 a.a. |
| Description : | This gene encodes a cytokine that functions in inflammation and the maturation of B cells. In addition, the encoded protein has been shown to be an endogenous pyrogen capable of inducing fever in people with autoimmune diseases or infections. The protein is primarily produced at sites of acute and chronic inflammation, where it is secreted into the serum and induces a transcriptional inflammatory response through interleukin 6 receptor, alpha. The functioning of this gene is implicated in a wide variety of inflammation-associated disease states, including suspectibility to diabetes mellitus and systemic juvenile rheumatoid arthritis. |
| Form : | Lyophilized from a 0.2 μM filtered solution of 20mM HAc-NaAc, 150mM NaCl, pH 5.0 |
| Bio-activity : | Recombinant IL-6 is fully biologically active when compared to standards. ED50 is less than 0.1 ng/ml as determined by the dose-dependent stimulation of human TF-1 cells. Specific Activity of 5.0 x 10⁷ IU/mg. |
| AA Sequence : | PVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALAENNLNLP KMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKA KNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRALRQM |
| Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
| Purity : | Greater than 98% as determined by RP-HPLC and reducing SDS-PAGE. |
| Storage : | Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months. |
| Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting.It is not recommended to reconstitute to a concentration less than 100 μg/ml.Dissolve the lyophilized protein in 1X PBS.Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
| Shipping : | The product is shipped at ambient temperature. |
| Gene Name | IL6 interleukin 6 (interferon, beta 2) [ Homo sapiens ] |
| Official Symbol | IL6 |
| Synonyms | IL6; interleukin 6 (interferon, beta 2); IFNB2; interleukin-6; BSF2; HGF; HSF; IL 6; CDF; BSF-2; IFN-beta-2; interferon beta-2; interleukin BSF-2; hybridoma growth factor; CTL differentiation factor; B-cell stimulatory factor 2; B-cell differentiation factor; IL-6; |
| Gene ID | 3569 |
| mRNA Refseq | NM_000600 |
| Protein Refseq | NP_000591 |
| MIM | 147620 |
| UniProt ID | P05231 |
| Chromosome Location | 7p21-p15 |
| Pathway | ATF-2 transcription factor network, organism-specific biosystem; Adipogenesis, organism-specific biosystem; African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Androgen Receptor Signaling Pathway, organism-specific biosystem; |
| Function | cytokine activity; cytokine activity; growth factor activity; interleukin-6 receptor binding; contributes_to interleukin-6 receptor binding; interleukin-6 receptor binding; |
| ◆ Recombinant Proteins | ||
| IL6-185M | Active Recombinant Mouse IL6 Protein | +Inquiry |
| IL6-61H | Recombinant Human IL6 Protein | +Inquiry |
| Il6-212M | Recombinant Active Mouse IL6 Protein, His-tagged(C-ter) | +Inquiry |
| IL6-2704R | Recombinant Rat IL6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| Il6-214M | Recombinant Mouse Il6 Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| IL6-01SFL | Recombinant Full Length Sheep IL6 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL6-5224HCL | Recombinant Human IL6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL6 Products
Required fields are marked with *
My Review for All IL6 Products
Required fields are marked with *
