Active Recombinant Human IL6R Protein (350 aa), N-His-tagged

Cat.No. : IL6R-139I
Product Overview : Recombinant human Soluble IL-6 Receptor Alpha (rhsIL-6R alpha) with an N-terminal His tag produced in Sf9 insect cells is a single glycosylated polypeptide chain containing 350 amino acids. A fully biologically active molecule, rhsIL-6R alpha has a molecular mass of 50kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Sf9 Cells
Protein Length : 350
Description : Interleukin-6 Receptor (IL-6R) is a single trans-membrane protein that is the receptor for Interleukin-6 (IL-6). IL-6R forms a hexameric complex upon binding 2 molecules of IL-6 and two molecules of glycoprotein 130 (gp130) which activates intracellular JAK/STAT pathways. Although the normal form of IL-6R is the membrane-bound 80 kDa subunit, a soluble form of IL-6R (sIL-6R) can be generated physiologically by limited proteolysis or alternative splicing. sIL-6R binds to both IL-6 and gp130 generating intracellular signaling. In the immune system, sIL-6R is produced by both naïve and memory CD4 T-cells and strongly augments IL-6 ligand's induction of Th-17 cells.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 50 ng/mL, measured by the cytotoxicity assay using M1 cells in presence of 10 ng/mL of human IL-6, corresponding to a specific activity of > 2 × 10^4 units/mg.
Molecular Mass : 50 kDa, observed by reducing SDS-PAGE.
AA Sequence : HHHHHHDDDDKLAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQD
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analyses.
Storage : Lyophilized recombinant human Soluble IL-6 Receptor Alpha (rhsIL-6R alpha) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhsIL-6R alpha remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name IL6R interleukin 6 receptor [ Homo sapiens (human) ]
Official Symbol IL6R
Synonyms IL6R; interleukin 6 receptor; IL6Q; gp80; CD126; HIES5; IL-6R; IL6RA; IL6RQ; IL-1Ra; IL-6RA; IL6QTL; IL-6R-1; interleukin-6 receptor subunit alphaCD126 antigenIL-6 receptor subunit alphamembrane glycoprotein 80
Gene ID 3570
mRNA Refseq NM_000565
Protein Refseq NP_000556
MIM 147880
UniProt ID P08887

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL6R Products

Required fields are marked with *

My Review for All IL6R Products

Required fields are marked with *

0
cart-icon