Active Recombinant Human IL6R Protein (350 aa), N-His-tagged
Cat.No. : | IL6R-139I |
Product Overview : | Recombinant human Soluble IL-6 Receptor Alpha (rhsIL-6R alpha) with an N-terminal His tag produced in Sf9 insect cells is a single glycosylated polypeptide chain containing 350 amino acids. A fully biologically active molecule, rhsIL-6R alpha has a molecular mass of 50kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Sf9 Cells |
Protein Length : | 350 |
Description : | Interleukin-6 Receptor (IL-6R) is a single trans-membrane protein that is the receptor for Interleukin-6 (IL-6). IL-6R forms a hexameric complex upon binding 2 molecules of IL-6 and two molecules of glycoprotein 130 (gp130) which activates intracellular JAK/STAT pathways. Although the normal form of IL-6R is the membrane-bound 80 kDa subunit, a soluble form of IL-6R (sIL-6R) can be generated physiologically by limited proteolysis or alternative splicing. sIL-6R binds to both IL-6 and gp130 generating intracellular signaling. In the immune system, sIL-6R is produced by both naïve and memory CD4 T-cells and strongly augments IL-6 ligand's induction of Th-17 cells. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 50 ng/mL, measured by the cytotoxicity assay using M1 cells in presence of 10 ng/mL of human IL-6, corresponding to a specific activity of > 2 × 10^4 units/mg. |
Molecular Mass : | 50 kDa, observed by reducing SDS-PAGE. |
AA Sequence : | HHHHHHDDDDKLAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQD |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% by SDS-PAGE and HPLC analyses. |
Storage : | Lyophilized recombinant human Soluble IL-6 Receptor Alpha (rhsIL-6R alpha) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhsIL-6R alpha remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | IL6R interleukin 6 receptor [ Homo sapiens (human) ] |
Official Symbol | IL6R |
Synonyms | IL6R; interleukin 6 receptor; IL6Q; gp80; CD126; HIES5; IL-6R; IL6RA; IL6RQ; IL-1Ra; IL-6RA; IL6QTL; IL-6R-1; interleukin-6 receptor subunit alphaCD126 antigenIL-6 receptor subunit alphamembrane glycoprotein 80 |
Gene ID | 3570 |
mRNA Refseq | NM_000565 |
Protein Refseq | NP_000556 |
MIM | 147880 |
UniProt ID | P08887 |
◆ Recombinant Proteins | ||
IL6R-786H | Active Recombinant Human IL6R protein, His-tagged | +Inquiry |
IL6R-335H | Recombinant Human IL6R Protein, His-tagged | +Inquiry |
IL6R-1418H | Recombinant Human IL6R Protein (Met1-Pro365), N-His tagged | +Inquiry |
IL6R-6383Z | Recombinant Zebrafish IL6R | +Inquiry |
Il6r-1145R | Recombinant Rat Il6r protein(Met1-Pro364), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL6R-2903HCL | Recombinant Human IL6R cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL6R Products
Required fields are marked with *
My Review for All IL6R Products
Required fields are marked with *
0
Inquiry Basket