Species : |
Human |
Source : |
Sf9 Cells |
Protein Length : |
350 |
Description : |
Interleukin-6 Receptor (IL-6R) is a single trans-membrane protein that is the receptor for Interleukin-6 (IL-6). IL-6R forms a hexameric complex upon binding 2 molecules of IL-6 and two molecules of glycoprotein 130 (gp130) which activates intracellular JAK/STAT pathways. Although the normal form of IL-6R is the membrane-bound 80 kDa subunit, a soluble form of IL-6R (sIL-6R) can be generated physiologically by limited proteolysis or alternative splicing. sIL-6R binds to both IL-6 and gp130 generating intracellular signaling. In the immune system, sIL-6R is produced by both naïve and memory CD4 T-cells and strongly augments IL-6 ligand's induction of Th-17 cells. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
ED50 < 50 ng/mL, measured by the cytotoxicity assay using M1 cells in presence of 10 ng/mL of human IL-6, corresponding to a specific activity of > 2 × 10^4 units/mg. |
Molecular Mass : |
50 kDa, observed by reducing SDS-PAGE. |
AA Sequence : |
HHHHHHDDDDKLAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQD |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 95% by SDS-PAGE and HPLC analyses. |
Storage : |
Lyophilized recombinant human Soluble IL-6 Receptor Alpha (rhsIL-6R alpha) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rhsIL-6R alpha remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
Reconstitution : |
Reconstituted in ddH2O at 100 μg/mL. |