Active Recombinant Human IL7 Full Length protein, His tagged

Cat.No. : IL7-507H
Product Overview : Recombinant Human IL7 protein(Asp26-His177), fused with C-terminal His tag, was expressed in HEK293.
Availability May 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : Asp26-His177
Tag : C-His
Form : Lyophilized from sterile PBS, pH7.4, 5% trehalose, 5% mannitol.
Bio-activity : Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL). The ED50 for this effect is 142.2 pg/mL.
Molecular Mass : The protein has a calculated MW of 18.2kDa, and migrates as an approximately 19-30kDa band in SDS-PAGE under reducing conditions.
Endotoxin : <1.0EU per 1μg (determined by the LAL method).
Purity : > 90 % as determined by SDS-PAGE.
Storage : Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.3 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH
Gene Name IL7 interleukin 7 [ Homo sapiens ]
Official Symbol IL7
Synonyms IL7; interleukin 7; interleukin-7; IL 7; IL-7;
Gene ID 3574
mRNA Refseq NM_000880
Protein Refseq NP_000871
MIM 146660
UniProt ID P13232

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All IL7 Products

Required fields are marked with *

My Review for All IL7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon