Active Recombinant Human IL7 Full Length protein, His tagged

• Cat.No.: IL7-507H
• Product Overview: Recombinant Human IL7 protein(Asp26-His177), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: Asp26-His177
• Tag: C-His
• Form: Lyophilized from sterile PBS, pH7.4, 5% trehalose, 5% mannitol.
• Bio-activity: Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL). The ED50 for this effect is 142.2 pg/mL.
• Molecular Mass: The protein has a calculated MW of 18.2kDa, and migrates as an approximately 19-30kDa band in SDS-PAGE under reducing conditions.
• Endotoxin: <1.0EU per 1μg (determined by the LAL method).
• Purity: > 90 % as determined by SDS-PAGE.
• Storage: Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.3 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH

Gene Information

• Gene Name: IL7 interleukin 7 [ Homo sapiens ]
• Official Symbol: IL7
• Synonyms: IL7; interleukin 7; interleukin-7; IL 7; IL-7
• Gene ID: 3574
• mRNA Refseq: NM_000880
• Protein Refseq: NP_000871
• MIM: 146660
• UniProt ID: P13232