Active Recombinant Human IL7 Full Length protein, His tagged
| Cat.No. : | IL7-507H |
| Product Overview : | Recombinant Human IL7 protein(Asp26-His177), fused with C-terminal His tag, was expressed in HEK293. |
| Availability | December 19, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | His |
| Protein Length : | Asp26-His177 |
| Tag : | C-His |
| Form : | Lyophilized from sterile PBS, pH7.4, 5% trehalose, 5% mannitol. |
| Bio-activity : | Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL). The ED50 for this effect is 142.2 pg/mL. |
| Molecular Mass : | The protein has a calculated MW of 18.2kDa, and migrates as an approximately 19-30kDa band in SDS-PAGE under reducing conditions. |
| Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
| Purity : | > 90 % as determined by SDS-PAGE. |
| Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.3 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH |
| Gene Name | IL7 interleukin 7 [ Homo sapiens ] |
| Official Symbol | IL7 |
| Synonyms | IL7; interleukin 7; interleukin-7; IL 7; IL-7; |
| Gene ID | 3574 |
| mRNA Refseq | NM_000880 |
| Protein Refseq | NP_000871 |
| MIM | 146660 |
| UniProt ID | P13232 |
| ◆ Recombinant Proteins | ||
| IL7-234I | Active Recombinant Human IL7 Protein, His-tagged | +Inquiry |
| IL7-3302C | Recombinant Chicken IL7 | +Inquiry |
| Il7-1683M | Recombinant Mouse Il7 Protein, His-tagged | +Inquiry |
| IL7-743R | Recombinant Rabbit IL7 protein, His-tagged | +Inquiry |
| IL7-2172M | Recombinant Mouse IL7 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IL7-5223HCL | Recombinant Human IL7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL7 Products
Required fields are marked with *
My Review for All IL7 Products
Required fields are marked with *
