Active Recombinant Human IL7 Full Length protein, His tagged
Cat.No. : | IL7-507H |
Product Overview : | Recombinant Human IL7 protein(Asp26-His177), fused with C-terminal His tag, was expressed in HEK293. |
Availability | September 07, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Asp26-His177 |
Tag : | C-His |
Form : | Lyophilized from sterile PBS, pH7.4, 5% trehalose, 5% mannitol. |
Bio-activity : | Measured in a cell proliferation assay using PHA-activated human peripheral blood lymphocytes (PBL). The ED50 for this effect is 142.2 pg/mL. |
Molecular Mass : | The protein has a calculated MW of 18.2kDa, and migrates as an approximately 19-30kDa band in SDS-PAGE under reducing conditions. |
Endotoxin : | <1.0EU per 1μg (determined by the LAL method). |
Purity : | > 90 % as determined by SDS-PAGE. |
Storage : | Store it under sterile conditions at -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.3 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH |
Gene Name | IL7 interleukin 7 [ Homo sapiens ] |
Official Symbol | IL7 |
Synonyms | IL7; interleukin 7; interleukin-7; IL 7; IL-7; |
Gene ID | 3574 |
mRNA Refseq | NM_000880 |
Protein Refseq | NP_000871 |
MIM | 146660 |
UniProt ID | P13232 |
◆ Recombinant Proteins | ||
IL7-146H | Active Recombinant Human IL7 protein | +Inquiry |
IL7-9011H | Active Recombinant Human IL7 | +Inquiry |
IL7-1559H | Recombinant human IL7, Active, His-tagged | +Inquiry |
IL7-52H | Active Recombinant Human Interleukin 7, HIgG1 Fc-tagged | +Inquiry |
IL7-234I | Active Recombinant Human IL7 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL7-5223HCL | Recombinant Human IL7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL7 Products
Required fields are marked with *
My Review for All IL7 Products
Required fields are marked with *