| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
Non |
| Description : |
Interferon-gamma (IFN-gamma) is a type II interferon and is expressed predominantly by CD8+ and CD4+ T cells, and natural killer (NK) cells. IFN-gamma acts as a potent activator of antigen presenting cells as well as inducing expression of IL-12, which in turn promotes a TH1 cell mediated immune response for clearing of viral and microbial infections. IFN-gamma activates non-specific tumoricidal activity in macrophages in addition to enhancing the cytotoxicity of NK cells. IFN-gamma can also directly inhibit proliferation of transformed cells or potentiate the antiviral and anti-tumor effects of the type I interferons. |
| Amino Acid Sequence : |
CYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ. |
| Molecular Mass : |
IFN-gamma migrates as a band between 20 and 25 kDa on SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified IFN-gamma that has a predicted molecular mass of 17.1 kDa. |
| pI : |
IFN-gamma separates into a number of glycoforms with a pI between 6 and 10 on 2D PAGE due to post-translational modifications, in particular glycosylation. |
| % Carbohydrate : |
IFN-gamma consists of 10-30% carbohydrate by weight. |
| Glycosylation : |
IFN-gamma has N-linked and possibly O-linked oligosaccharides. |
| Purity : |
>95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue. |
| Formulation : |
When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. |
| Reconstitution : |
It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
| Storage : |
Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended. |
| Activity : |
The ED50 of IFN-gamma is typically 0.01 - 0.02 ng/ml as measured in a cell prolipheration assay using the human growth factor-dependant M-07e cell line. |