Active Recombinant Human Interferon, Gamma
Cat.No. : | IFNG-26H |
Product Overview : | Recombinant Human Interferon encoding the full-length human Interferon-gamma (IFN-g) protein was expressed in modifiedhuman 293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Non |
Description : | Interferon-gamma (IFN-gamma) is a type II interferon and is expressed predominantly by CD8+ and CD4+ T cells, and natural killer (NK) cells. IFN-gamma acts as a potent activator of antigen presenting cells as well as inducing expression of IL-12, which in turn promotes a TH1 cell mediated immune response for clearing of viral and microbial infections. IFN-gamma activates non-specific tumoricidal activity in macrophages in addition to enhancing the cytotoxicity of NK cells. IFN-gamma can also directly inhibit proliferation of transformed cells or potentiate the antiviral and anti-tumor effects of the type I interferons. |
Amino Acid Sequence : | CYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ. |
Molecular Mass : | IFN-gamma migrates as a band between 20 and 25 kDa on SDS-PAGE due to post-translation modifications, in particular glycosylation. This compares with the unmodified IFN-gamma that has a predicted molecular mass of 17.1 kDa. |
pI : | IFN-gamma separates into a number of glycoforms with a pI between 6 and 10 on 2D PAGE due to post-translational modifications, in particular glycosylation. |
% Carbohydrate : | IFN-gamma consists of 10-30% carbohydrate by weight. |
Glycosylation : | IFN-gamma has N-linked and possibly O-linked oligosaccharides. |
Purity : | >95%, as determined by SDS-PAGE and visualized by Coomassie Brilliant Blue. |
Formulation : | When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. |
Reconstitution : | It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
Storage : | Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-term storage at 4°C is recommended, and longer-term storage of aliquots at -18 to -20°C. Repeated freeze thawing is not recommended. |
Activity : | The ED50 of IFN-gamma is typically 0.01 - 0.02 ng/ml as measured in a cell prolipheration assay using the human growth factor-dependant M-07e cell line. |
Gene Name | IFNG interferon, gamma [ Homo sapiens ] |
Synonyms | IFNG; interferon, gamma; IFG; IFI; IFN-gamma; Immune interferon; interferon, gamma |
Gene ID | 3458 |
mRNA Refseq | NM_000619 |
Protein Refseq | NP_000610 |
UniProt ID | P01579 |
Chromosome Location | 12q14 |
MIM | 147570 |
Pathway | Allograft rejection; Cytokine-cytokine receptor interaction; Graft-versus-host disease; Jak-STAT signaling pathway; Natural killer cell mediated cytotoxicity; Proteasome; Regulation of autophagy; Systemic lupus erythematosus; cell receptor signaling pathway; TGF-beta signaling pathway; Type I diabetes mellitus |
Function | cytokine activity; interferon-gamma receptor binding |
◆ Recombinant Proteins | ||
IFNG-72HFL | Recombinant Full Length Human IFNG Protein, C-Flag-tagged | +Inquiry |
IFNg-19E | Recombinant Equine IFN gamma | +Inquiry |
IFNG-4340F | Recombinant Ferret IFNG Protein | +Inquiry |
IFNG-116M | Active Recombinant Mouse IFNG Protein | +Inquiry |
IFNG-61B | Active Recombinant Bovine Interferon, Gamma | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *
0
Inquiry Basket