| Species : |
Human |
| Source : |
HEK293 |
| Tag : |
Non |
| Description : |
Interleukin-17 (IL-17) is a 155 amino acid protein that is a disulfide linked, homodimeric,secreted glycoprotein with one N-linked glycosylation site. IL-17 is also referred to as IL-17A. Other members include IL-17B, IL-17C, IL-17D, IL-17E and IL-17F. IL-17 binds tothe cell surfacer receptor IL-17R. IL-17 is secreted by a subset of T cells called T-helper 17 (Th-17) cells. IL-23 is thought to mediate the production of IL-17 by Th-17 cells. |
| Amino Acid Sequence : |
GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVLRREPPHCPNSFRLEKILVSVGCTCVTPIVHHVA. |
| Molecular Mass : |
Under reducing conditions Apollo IL-17A hcx migrates as two bands at approximately 16and 22 kDa on SDS-PAGE due to post-translational modifications. |
| pI : |
Apollo IL-17A hcx has a predicted pI of 8.62. |
| Glycosylation : |
Apollo IL-17A hcx contains N--linked oligosaccharides. |
| Purity : |
>95%, as determined by SDS-PAGE, visualised by Coomassie Brilliant Blue. |
| Formulation : |
When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose. |
| Reconstitution : |
It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. |
| Storage : |
Lyophilized products should be stored at 2 to 8°C. Following reconstitution short-termstorage at 4°C and longer-term storage of aliquots at -18 to -20°C is recommended. Repeated freeze thawing is not recommended. |
| Activity : |
The activity of IL-17A is measured by its ability to induce IL-6 production in NHDF cells. The ED50is typically between 0.5 and 1.5 ng/ml. |