Active Recombinant Human Janus kinase 2 Protein, His Tagged
Cat.No. : | JAK2-27628TH |
Product Overview : | Active Recombinant Human Janus kinase 2 Protein (808-1132 aa) with His tag was expressed in Baculovirus-Insect Cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 808-1132 aa |
Description : | This gene encodes a non-receptor tyrosine kinase that plays a central role in cytokine and growth factor signalling. The primary isoform of this protein has an N-terminal FERM domain that is required for erythropoietin receptor association, an SH2 domain that binds STAT transcription factors, a pseudokinase domain and a C-terminal tyrosine kinase domain. Cytokine binding induces autophosphorylation and activation of this kinase. This kinase then recruits and phosphorylates signal transducer and activator of transcription (STAT) proteins. Growth factors like TGF-beta 1 also induce phosphorylation and activation of this kinase and translocation of downstream STAT proteins to the nucleus where they influence gene transcription. Mutations in this gene are associated with numerous inflammatory diseases and malignancies. This gene is a downstream target of the pleiotropic cytokine IL6 that is produced by B cells, T cells, dendritic cells and macrophages to produce an immune response or inflammation. Disregulation of the IL6/JAK2/STAT3 signalling pathways produces increased cellular proliferation and myeloproliferative neoplasms of hematopoietic stem cells. A nonsynonymous mutation in the pseudokinase domain of this gene disrupts the domains inhibitory effect and results in constitutive tyrosine phosphorylation activity and hypersensitivity to cytokine signalling. This gene and the IL6/JAK2/STAT3 signalling pathway is a therapeutic target for the treatment of excessive inflammatory responses to viral infections. Alternative splicing results in multiple transcript variants encoding distinct isoforms. |
Molecular Mass : | 38 kDa |
AA Sequence : | MHHHHHHHHLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG |
Bio-Activity : | The specific activity of JAK2 was determined to be 234 nmol/min/mg as per activity assay protocol. JAK2 can digest IGF1Rtide synthetic peptide substrate (KKKSPGEYVNIEFG) while consuming ATP to produce ADP. The JAK2 assay is performed using the ADP-GloTM Kinase Assay kit which quantifies the amount of ADP produced by the JAK2 reaction. The ADP-GloTM Reagent is added to terminate the kinase reaction and to deplete the remaining ATP, and then the Kinase Detection Reagent is added to convert ADP to ATP and to measure the newly synthesized ATP using luciferase/luciferin reaction. |
Purity : | > 90 % by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile 40mM Tris, pH8.0, 110mM NaCl, 2.2mM KCl, 3mM DTT, 20 % Glycerol, 0.04 % Tween-20 |
Concentration : | 0.27 mg/mL by BCA |
Gene Name | JAK2 Janus kinase 2 [ Homo sapiens (human) ] |
Official Symbol | JAK2 |
Synonyms | JAK2; Janus kinase 2; tyrosine-protein kinase JAK2; JTK10; JAK-2; Janus kinase 2 (a protein tyrosine kinase); THCYT3 |
Gene ID | 3717 |
mRNA Refseq | NM_004972 |
Protein Refseq | NP_004963 |
MIM | 147796 |
UniProt ID | O60674 |
◆ Recombinant Proteins | ||
JAK2-33H | Recombinant Human JAK2 (JH2 Domain) (W659A, W777A,F794H) Protein, His-tagged | +Inquiry |
JAK2-157H | Recombinant Human JAK2 protein, His/MBP-tagged | +Inquiry |
JAK2-598H | Recombinant Human JAK2 protein, His-tagged | +Inquiry |
JAK2-5439H | Recombinant Human Janus Kinase 2, GST-tagged | +Inquiry |
JAK2-2252C | Recombinant Chicken JAK2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JAK2 Products
Required fields are marked with *
My Review for All JAK2 Products
Required fields are marked with *