Recombinant Human JAK2 protein, His-tagged
| Cat.No. : | JAK2-3128H |
| Product Overview : | Recombinant Human JAK2 protein(O60674)(752-1132aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 752-1132aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 48.6 kDa |
| AA Sequence : | KPLSALDSQRKLQFYEDRHQLPAPKWAELANLINNCMDYEPDFRPSFRAIIRDLNSLFTPDYELLTENDMLPNMRIGALGFSGAFEDRDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTGEVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGSLRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFGLTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKSPPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSFRDLALRVDQIRDNMAG |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | JAK2 Janus kinase 2 [ Homo sapiens ] |
| Official Symbol | JAK2 |
| Synonyms | JAK2; Janus kinase 2; tyrosine-protein kinase JAK2; JTK10; JAK-2; Janus kinase 2 (a protein tyrosine kinase); THCYT3; |
| Gene ID | 3717 |
| mRNA Refseq | NM_004972 |
| Protein Refseq | NP_004963 |
| MIM | 147796 |
| UniProt ID | O60674 |
| ◆ Recombinant Proteins | ||
| JAK2-177HFL | Recombinant Full Length Human JAK2 Protein, C-Flag-tagged | +Inquiry |
| JAK2-158H | Recombinant Human JAK2 protein, His/MBP-tagged | +Inquiry |
| JAK2-3184H | Recombinant Human JAK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| JAK2-2252C | Recombinant Chicken JAK2 | +Inquiry |
| Jak2-255M | Recombinant Mouse Jak2 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All JAK2 Products
Required fields are marked with *
My Review for All JAK2 Products
Required fields are marked with *
