Active Recombinant Human KLK1 Protein (262 aa), C-6×His-tagged

Cat.No. : KLK1-089K
Product Overview : Recombinant Human KLK1 Protein with C-6×His tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 262
Description : Kallikreins are members of a highly conserved serine proteases that are involved in the post-translational modification of many polypeptides, and plays a role in diverse physiological processes. Fifteen kallikreins who seen coding genes are located in a cluster on chromosome 19 have been reported, and growing evidence suggests that many kallikreins are implicated in carcinogens is and some have potential as novel cancer and other disease biomakers. Human kallikrein1(KLK1), also known as tissue kallikrein, is functionally conserved in its capacity to cleave the low molecular weight kininogen to release the vasoactive peptide, Lys-bradykinin which plays a role in regulating vasodilation, blood pressure reduction, smooth muscle relaxation and contraction, pain induction and inflammation.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Measured by its ability to cleave a flourogenic peptide substrate Pro-Phe-Arg-7-amido-4-methylcoumarin (PFRAMC). The specific activity is > 2,000 pmoles/min/μg.
Molecular Mass : Approximately 29.7 kDa, a single non-glycosylated polypeptide chain containing 262 amino acids with 6 × His at C-terminus.
AA Sequence : MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWVLTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHDLMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKILPNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNKPSVAVRVLSYVKWIEDTIAENSHHHHHH
Endotoxin : Less than 1 EU/mg of rHuKLK-1 as determined by LAL method.
Purity : >90% by SDS-PAGE and HPLC analyses.
Storage : This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles.
Storage Buffer : Lyophilized from a 0.2mm filtered concentrated solution in PBS, pH 7.4.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name KLK1 kallikrein 1 [ Homo sapiens ]
Official Symbol KLK1
Synonyms KLK1; kallikrein 1; kallikrein 1, renal/pancreas/salivary; kallikrein-1; Klk6; tissue kallikrein; glandular kallikrein 1; kallikrein serine protease 1; kidney/pancreas/salivary gland kallikrein; hK1; KLKR;
Gene ID 3816
mRNA Refseq NM_002257
Protein Refseq NP_002248
MIM 147910
UniProt ID P06870

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLK1 Products

Required fields are marked with *

My Review for All KLK1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon