Active Recombinant Human MAPT Protein
| Cat.No. : | MAPT-516H |
| Product Overview : | Active Human Recombinant Tau (K18), P301L mutant Protein (Pre-formed Fibrils) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Description : | This gene encodes the microtubule-associated protein tau (MAPT) whose transcript undergoes complex, regulated alternative splicing, giving rise to several mRNA species. MAPT transcripts are differentially expressed in the nervous system, depending on stage of neuronal maturation and neuron type. MAPT gene mutations have been associated with several neurodegenerative disorders such as Alzheimer's disease, Pick's disease, frontotemporal dementia, cortico-basal degeneration and progressive supranuclear palsy. |
| Bio-activity : | Thioflavin T emission curve shows increased fluorescence (correlated to tau protein fibrillation) when active tau PFFs are combined with active tau monomers. |
| Molecular Mass : | ~15.1 kDa |
| AA Sequence : | SRLQTAPVPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGSKDNIKHVLGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSKIGSLDNITHVPGGGNKKIETHKLTFRE |
| Purity : | >95% |
| Applications : | WB, SDS-PAGE, In vivo assay, In vitro assay |
| Usage : | Not for use in humans. Not for use in diagnostics or therapeutics. For in vitro research use only. |
| Storage : | At -80 centigrade. |
| Storage Buffer : | 10 mM HEPES, 100 mM NaCl pH 7.4 |
| Gene Name | MAPT microtubule associated protein tau [ Homo sapiens (human) ] |
| Official Symbol | MAPT |
| Synonyms | MAPT; microtubule associated protein tau; TAU; MSTD; PPND; DDPAC; MAPTL; MTBT1; MTBT2; FTDP-17; PPP1R103. microtubule-associated protein tau; G protein beta1/gamma2 subunit-interacting factor 1; PHF-tau; neurofibrillary tangle protein; paired helical filament-tau; protein phosphatase 1, regulatory subunit 103 |
| Gene ID | 4137 |
| mRNA Refseq | NM_016841 |
| Protein Refseq | NP_058525 |
| MIM | 157140 |
| UniProt ID | P10636 |
| ◆ Recombinant Proteins | ||
| MAPT-96H | Recombinant Human MAPT | +Inquiry |
| MAPT-555H | Recombinant Human MAPT Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MAPT-144H | Recombinant Human Tau-441 (S352L) | +Inquiry |
| MAPT-2887H | Recombinant Human MAPT protein(1-441 aa, Tau217), C-His-tagged | +Inquiry |
| MAPT-2891H | Recombinant Human MAPT protein(1-441 aa, Tau231), C-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MAPT-4477HCL | Recombinant Human MAPT 293 Cell Lysate | +Inquiry |
| MAPT-4476HCL | Recombinant Human MAPT 293 Cell Lysate | +Inquiry |
| MAPT-4478HCL | Recombinant Human MAPT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAPT Products
Required fields are marked with *
My Review for All MAPT Products
Required fields are marked with *
