| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
106-263 aa |
| Description : |
This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This protease degrades soluble and insoluble elastin. This gene may play a role in aneurysm formation and mutations in this gene are associated with lung function and chronic obstructive pulmonary disease (COPD). This gene is part of a cluster of MMP genes on chromosome 11. |
| Bio-activity : |
> 40 U/μg. Activity described as U=100 pmol/min at 25 centigrade using a colorimetric assay with thiopeptide Ac-Pro-Leu-Gly-[2-mercapto-4-methyl-pentanoyl]-Leu-Gly-OC2H5 (Biomol) as substrate. |
| Molecular Mass : |
17.6 kDa |
| AASequence : |
M-GPVWRKHYITYRINNYTPDMNREDVDYAIRKAFQVWSNVTPLKFS160170180190200KINTGMADILVVFARGAHGDFHAFDGKGGILAHAFGPGSGIGGDAHFDED210210220230240EFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRL250SADDIRGIQSLYG |
| Purity : |
> 95% by SDS-PAGE. The protein is observed, in denaturing conditions, as a single band migrating at a molecular weight between 14.4 and 18.4 kDa. |
| Applications : |
Enzyme kinetic studies, cleavage of target substrates and screening of inhibitors. |
| Storage : |
At -80 centigrade. After initial defrost, aliquot the product into individual tubes and refreeze at -80 centigrade.
Avoid repeated freeze/thaw cycles. |
| Concentration : |
0.2 mg/mL. The concentration is calculated by the analysis of the absorbance at 280 nm, (ε280 = 26930 M-1cm-1 calculated). |
| Shipping : |
Dry Ice |
| Storage Buffer : |
Tris 20 mM pH 7.2, CaCl2 10 mM, ZnCl2 0.1 mM, NaCl 0.3 M, acetohydroxamic acid (AHA) 0.2 M. |
