Active Recombinant Human MMP3 Protein, mutation F171D, Tag Free, No Activation Required

• Cat.No.: MMP3-26H
• Product Overview: Recombinant matrix metalloproteinase-3 (MMP-3, stromelysin-1, transin) cloned from human cDNA, expressed in E.coli. The enzyme consists of the catalytic domain of human MMP-3, residues 105-265 (UniProtKB accession P08254) with the mutation F171D. The protein has been mutated to increase its stability, as the mutation drastically reduces the enzyme's rate of autoproteolysis. The catalytic activity rates are not affected by the mutation.

Specification

• Species: Human
• Source: E.coli
• Tag: Non
• Protein Length: 100-272 aa
• Description: Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This gene encodes an enzyme which degrades fibronectin, laminin, collagens III, IV, IX, and X, and cartilage proteoglycans. The enzyme is thought to be involved in wound repair, progression of atherosclerosis, and tumor initiation. The gene is part of a cluster of MMP genes which localize to chromosome 11q22.3.
• Bio-activity: > 30 U/μg. Activity described as U=100 pmol/min at 37 centigrade using a colorimetric assay with thiopeptolide Ac-Pro-Leu-Gly-[2- mercapto-4-methyl-pentanoyl]-Leu-Gly-OC2H5 (Biomol) as substrate.
• Molecular Mass: 19.5 kDa
• AASequence: M-FRTFPGIPKWRKTHLTYRIVN130140150160170180YTPDLPKDAVDSAVEKALKVWEEVTPLTFSRLYEGEADIMISFAVREHGDDYPFDGPGNV190200210220230240LAHAYAPGPGINGDAHFDDDEQWTKDTTGTNLFLVAAHEIGHSLGLFHSANTEALMYPLY250260265HSLTDLTRFRLSQDDINGIQSLYGP
• Purity: > 95% by SDS-PAGE. The protein is observed, in denaturing conditions, as a single band migrating at a molecular weight between 18.4 and 25.0 kDa.
• Applications: Enzyme kinetic studies, cleavage of target substrates and screening of inhibitors.
• Storage: At -80 centigrade. After initial defrost, aliquot the product into individual tubes and refreeze at -80 centigrade. Avoid repeated freeze/thaw cycles.
• Concentration: 0.2 mg/mL. The concentration is calculated by the analysis of the absorbance at 280 nm (ε280 = 28420 M-1cm-1 calculated).
• Shipping: Dry Ice
• Storage Buffer: Tris 20 mM, pH 7.2, CaCl2 10 mM, ZnCl2 0.1 mM, NaCl 0.3 M, acetohydroxamic acid (AHA) 0.2 M.

Gene Information

• Gene Name: MMP3 matrix metallopeptidase 3 (stromelysin 1, progelatinase) [ Homo sapiens (human) ]
• Official Symbol: MMP3
• Synonyms: MMP3; matrix metallopeptidase 3 (stromelysin 1, progelatinase); matrix metalloproteinase 3 (stromelysin 1, progelatinase) , STMY, STMY1; stromelysin-1; transin-1; proteoglycanase; matrix metalloproteinase-3; matrix metalloproteinase 3 (stromelysin 1, progelatinase); SL-1; STMY; STR1; CHDS6; MMP-3; STMY1; MGC126102; MGC126103; MGC126104; 3.4.24.17
• Gene ID: 4314
• mRNA Refseq: NM_002422
• Protein Refseq: NP_002413
• MIM: 185250
• UniProt ID: P08254