| Species : |
Human |
| Source : |
E.coli |
| Tag : |
Non |
| Protein Length : |
95-267 aa |
| Description : |
This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This secreted protease breaks down proteoglycans, fibronectin, elastin and casein and differs from most MMP family members in that it lacks a conserved C-terminal hemopexin domain. The enzyme is involved in wound healing, and studies in mice suggest that it regulates the activity of defensins in intestinal mucosa. The gene is part of a cluster of MMP genes on chromosome 11. This gene exhibits elevated expression levels in multiple human cancers. |
| Bio-activity : |
> 8 U/μg. Activity described as U=100 pmol/min at 25 centigrade using a colorimetric assay with thiopeptide Ac-Pro-Leu-Gly-[2- mercapto-4-methyl-pentanoyl]-Leu-Gly-OC2H5 (Biomol) as substrate. |
| Molecular Mass : |
19.3 kDa |
| AASequence : |
M-YSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEI150160170180190PLHFRKVVWGTADIMIGFARGAHGDSYPFDGPGNTLAHAFAPGTGLGGDA200210220230240HFDEDERWTDGSSLGINFLYAATHELGHSLGMGHSSDPNAVMYPTYGNGD250260PQNFKLSQDDIKGIQKLYGKRSNSRKK |
| Purity : |
> 95% by SDS-PAGE. The protein is observed, in denaturing conditions, as a single band migrating at a molecular weight between 18.8 kDa and 25.0 kDa. |
| Applications : |
Enzyme kinetic studies, cleavage of target substrates and screening of inhibitors. |
| Storage : |
At -80 centigrade. After initial defrost, aliquot the product into individual tubes and refreeze at -80 centigrade.
Avoid repeated freeze/thaw cycles. |
| Concentration : |
0.1 mg/mL. The concentration is calculated by the analysis of the absorbance at 280 nm (ε280 = 33920 M-1cm-1 calculated). |
| Shipping : |
Dry Ice |
| Storage Buffer : |
Tris 20 mM pH 7.2, CaCl2 10 mM, ZnCl2 0.1 mM, NaCl 0.3 M, acetohydroxamic acid (AHA) 0.5 M. |
